BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0829 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) 74 1e-13 SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) 37 0.013 SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) 31 0.66 SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_39938| Best HMM Match : ANF_receptor (HMM E-Value=6.4e-14) 30 1.5 SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) 30 1.5 SB_57255| Best HMM Match : Atrophin-1 (HMM E-Value=0.91) 30 2.0 SB_20129| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_34021| Best HMM Match : Zip (HMM E-Value=0) 30 2.0 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 29 2.7 SB_29288| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_32651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_7539| Best HMM Match : Sulfatase (HMM E-Value=3.5e-05) 29 4.7 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 28 6.2 SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_9325| Best HMM Match : Exo_endo_phos (HMM E-Value=0.081) 28 8.1 SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_46525| Best HMM Match : Thymosin (HMM E-Value=0) Length = 750 Score = 73.7 bits (173), Expect = 1e-13 Identities = 38/79 (48%), Positives = 49/79 (62%), Gaps = 2/79 (2%) Frame = +1 Query: 232 PEVF--IRRYEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTE 405 PEV + FD+S+LKH E QEKNPLP KD I E + + ++ FD +KLKH + Sbjct: 674 PEVLPDVSAVASFDASKLKHVEVQEKNPLPTKDDITTESTETR--AEVKTFDHSKLKHVQ 731 Query: 406 TCEKNPLPTKDVIEQEKSA 462 T EKNPLP I QEK++ Sbjct: 732 TEEKNPLPDAKTIAQEKAS 750 Score = 70.5 bits (165), Expect = 1e-12 Identities = 38/76 (50%), Positives = 50/76 (65%), Gaps = 2/76 (2%) Frame = +1 Query: 232 PEVFIRRYE--KFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTE 405 PEV R E KFD+S+LKH ET+EK +P KD IEAE ++ +++FD +KLKH Sbjct: 522 PEVLPDRSEVAKFDTSKLKHVETKEKVVMPTKDVIEAEAIDSR--AEVKSFDHSKLKHVV 579 Query: 406 TCEKNPLPTKDVIEQE 453 T EKNPLPT + +E Sbjct: 580 TQEKNPLPTPQTLHEE 595 Score = 69.7 bits (163), Expect = 2e-12 Identities = 33/68 (48%), Positives = 47/68 (69%), Gaps = 2/68 (2%) Frame = +1 Query: 259 KFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIE--NFDPTKLKHTETCEKNPLPT 432 KFD++ LKH +T+EKN LP + I+ E + ++F + E +F+ +KL+H ET EKN LPT Sbjct: 416 KFDAANLKHVQTKEKNTLPSDETIKQELQPDEFPDRAEVKSFEKSKLQHVETKEKNTLPT 475 Query: 433 KDVIEQEK 456 KD I EK Sbjct: 476 KDTIADEK 483 Score = 69.7 bits (163), Expect = 2e-12 Identities = 38/76 (50%), Positives = 45/76 (59%), Gaps = 2/76 (2%) Frame = +1 Query: 232 PEVFIRRYE--KFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTE 405 P+ F R E F+ S+L+H ET+EKN LP KD I EK F +G+E F KLKH E Sbjct: 445 PDEFPDRAEVKSFEKSKLQHVETKEKNTLPTKDTIADEKRTAPF-SGVEVFQKNKLKHVE 503 Query: 406 TCEKNPLPTKDVIEQE 453 T EKNPLP I E Sbjct: 504 TLEKNPLPDAQNIRAE 519 Score = 68.1 bits (159), Expect = 6e-12 Identities = 33/70 (47%), Positives = 43/70 (61%), Gaps = 2/70 (2%) Frame = +1 Query: 256 EKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKF--LNGIENFDPTKLKHTETCEKNPLP 429 + FD S+LKH ET EKNPLP ++ E ++ + +FD +KLKH E EKNPLP Sbjct: 644 KSFDHSKLKHVETVEKNPLPSAAVLKEEMRPEVLPDVSAVASFDASKLKHVEVQEKNPLP 703 Query: 430 TKDVIEQEKS 459 TKD I E + Sbjct: 704 TKDDITTEST 713 Score = 60.9 bits (141), Expect = 9e-10 Identities = 28/64 (43%), Positives = 45/64 (70%) Frame = +1 Query: 262 FDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDV 441 FD ++LKH TQEK+ +P ++ I+ E ++ +++FD +KLKH ET EKNPLP+ V Sbjct: 610 FDHTKLKHVTTQEKSIMPSQEDIKEEAVDSRA--EVKSFDHSKLKHVETVEKNPLPSAAV 667 Query: 442 IEQE 453 +++E Sbjct: 668 LKEE 671 Score = 58.8 bits (136), Expect = 4e-09 Identities = 31/68 (45%), Positives = 44/68 (64%), Gaps = 2/68 (2%) Frame = +1 Query: 256 EKFDSSQLKHTETQEKNPLPDKDAIEAEK-EKNK-FLNGIENFDPTKLKHTETCEKNPLP 429 + FD S+LKH TQEKNPLP + E KNK + + +FD TKLKH T EK+ +P Sbjct: 568 KSFDHSKLKHVVTQEKNPLPTPQTLHEELIPKNKPDRSEVASFDHTKLKHVTTQEKSIMP 627 Query: 430 TKDVIEQE 453 +++ I++E Sbjct: 628 SQEDIKEE 635 Score = 35.1 bits (77), Expect = 0.054 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 367 IENFDPTKLKHTETCEKNPLPTKDVIEQE 453 + FD LKH +T EKN LP+ + I+QE Sbjct: 414 VAKFDAANLKHVQTKEKNTLPSDETIKQE 442 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/40 (37%), Positives = 28/40 (70%) Frame = +2 Query: 107 LPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 226 +P+V D +S++ F+TS L+ V+T EK+V+P+ + + E Sbjct: 521 MPEVLPD-RSEVAKFDTSKLKHVETKEKVVMPTKDVIEAE 559 Score = 31.5 bits (68), Expect = 0.66 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = +2 Query: 107 LPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 226 +PK D +S++ F+ + L+ V T EK ++PS ED+ E Sbjct: 597 IPKNKPD-RSEVASFDHTKLKHVTTQEKSIMPSQEDIKEE 635 >SB_45518| Best HMM Match : Prothymosin (HMM E-Value=0.9) Length = 413 Score = 37.1 bits (82), Expect = 0.013 Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = +2 Query: 95 SLKDLPKVATDLKSQLEGFNTSCL-RDVDTNEKIVLPSAEDVATEKTQKSLFDGTR 259 SLK L K+ TDL+S ++G ++ L ++V+ K+V + +T K + S F+ ++ Sbjct: 333 SLKALAKICTDLESNIQGIKSNPLAKEVERTNKLVYEIFKKFSTSKVEASSFENSK 388 >SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) Length = 1452 Score = 31.5 bits (68), Expect = 0.66 Identities = 20/64 (31%), Positives = 28/64 (43%) Frame = +1 Query: 262 FDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDV 441 +D Q K E PD+D +E E+E NG+E+ D K + PT DV Sbjct: 839 YDVKQRKRLEQHASYEAPDEDEMEIERE---LQNGLESGDEDDTKADAQRSETNSPTLDV 895 Query: 442 IEQE 453 Q+ Sbjct: 896 ETQQ 899 >SB_14886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1028 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +3 Query: 474 FITVTRKCISLVRRILILM*VRSICVVHYKFYFCFCTMGNTAWGNGRRTATP 629 F T +SL R ++ +R IC VH FY+C C + A G A P Sbjct: 39 FRLATHVILSLESRDTLVAVLR-ICSVHLDFYYCTCVWSSMAGVPGSLMADP 89 >SB_39938| Best HMM Match : ANF_receptor (HMM E-Value=6.4e-14) Length = 966 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 300 EEPASGQRCYRSGEGKEQIPERHRELRSH*AEAHGNVREEP 422 EEP+ + +G KE+ E RE R H + V+EEP Sbjct: 840 EEPSDEEESEEAGREKEEEEEDQREGRDHNDDEESVVKEEP 880 >SB_58909| Best HMM Match : Renin_r (HMM E-Value=1.6e-05) Length = 385 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/48 (41%), Positives = 27/48 (56%) Frame = -1 Query: 232 GLLSGDVFSRRKHNLFIGVDVTETAGVEAFELTLQVCGDLGEVFQGGS 89 GLL+GD+F R K N+ I VD T G + FEL + + E+ GS Sbjct: 74 GLLAGDIFRRPKANILISVDGV-TKG-DKFELPAKASFPVQEMAGLGS 119 >SB_57255| Best HMM Match : Atrophin-1 (HMM E-Value=0.91) Length = 1249 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 77 SVSDTPSLKDLPKVATDLKSQLEGFNTSCLRDV-DTNEKIVLPSAEDVAT 223 S SD P+ D A+D+KS + T DV T++ V PSA DV T Sbjct: 617 SASDVPTTSDDQPSASDVKSTSDDQVTPPSSDVPTTSDDQVTPSASDVPT 666 >SB_20129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = -1 Query: 232 GLLSGDVFSRRKHNLFIGVDVTETAGVEAFEL 137 GLL+GD+F R K N+ I VD T G + FEL Sbjct: 51 GLLAGDIFRRPKANILISVDGV-TKG-DKFEL 80 >SB_34021| Best HMM Match : Zip (HMM E-Value=0) Length = 808 Score = 29.9 bits (64), Expect = 2.0 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 220 H*EDPEVFIRRYEKFDSSQLKHTETQEKNPLPDKDAIEA 336 H +P+ + +E FDS LKH ++ N +P+ + + Sbjct: 370 HEHEPKQDLYHHEDFDSYSLKHERVKQSNTVPNPSKVRS 408 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 25 ESSIPFLIKNILIHNGLLRE*HSLPERPPQGRHRPEESARRLQHQ 159 E S+PF N N ++ +P R PQG H + A+ +QH+ Sbjct: 224 EMSLPFKKHNTFRQNVDIK---GIPSRLPQGEHSDRKKAQEVQHK 265 >SB_29288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 275 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +1 Query: 280 KHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEK 417 +HTE + +P P K I+ E +++ + I+ KH+ +CE+ Sbjct: 212 RHTENAKSSPDPIKSEIDGEHSEDEKEHKIKVCPLVDKKHSHSCER 257 >SB_32651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 28.7 bits (61), Expect = 4.7 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 5/71 (7%) Frame = +1 Query: 259 KFDSSQLKHTETQEKNPLPDKDAIEAEK-----EKNKFLNGIENFDPTKLKHTETCEKNP 423 K+ SSQ+ ET++ K ++E+ EK N +N + TK +H++ EKN Sbjct: 166 KYSSSQIDKLETKQAIKSKKKKRRKSEEKELLGEKVDQFNSKKNLNRTKERHSKKMEKNR 225 Query: 424 LPTKDVIEQEK 456 Q+K Sbjct: 226 QDNSKTRSQQK 236 >SB_7539| Best HMM Match : Sulfatase (HMM E-Value=3.5e-05) Length = 492 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -3 Query: 227 SQWRRLQQTEAQSFHWCRRHGDSWC*SLRADSSGLWRPW 111 S WRRLQ+ A S + + D +L A+ G W PW Sbjct: 419 SLWRRLQELNATSLEYRLQPEDPRSIAL-AERLGRWEPW 456 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +2 Query: 98 LKDLPKVATDLKSQLEGFNTSCLRDVDTNEKIVLPSAEDVATE 226 L DL +V +LKS+ EG CL D++ + DV E Sbjct: 1125 LMDLSRVGEELKSENEGLQQKCL-DLEKQRDTIKQDLADVQKE 1166 >SB_14617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 28.3 bits (60), Expect = 6.2 Identities = 24/73 (32%), Positives = 31/73 (42%), Gaps = 5/73 (6%) Frame = +3 Query: 165 SVTSTPMKRLCFRLLKTSPLRRPRSLY-----STVREV*FEPAEAHRDSGEEPASGQRCY 329 SVT T +RL R S L PRS+ T+ + A R GEE G+ Y Sbjct: 438 SVTGTFARRLVSRTTDASSLEDPRSVVVTSSPRTLGRISNGTTSARRVEGEEHVCGE--Y 495 Query: 330 RSGEGKEQIPERH 368 + KE +P H Sbjct: 496 KCSLCKEVVPPDH 508 >SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1045 Score = 27.9 bits (59), Expect = 8.1 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 8/69 (11%) Frame = +1 Query: 232 PEVFIRRYEKFDSSQL--KHTETQEKNPL---PDKDAIEAEKEK-NKFLN--GIENFDPT 387 PE +Y+ FD ++ +TQEK PL DK+ EA + N+ + I N P Sbjct: 366 PEAKQGKYD-FDPTETPASRDKTQEKQPLEKTKDKEKEEANRRSYNRMASYESIGNIGPE 424 Query: 388 KLKHTETCE 414 K K ++CE Sbjct: 425 KSKSAKSCE 433 >SB_9325| Best HMM Match : Exo_endo_phos (HMM E-Value=0.081) Length = 249 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 207 LKTSPLRRPRSLYSTVREV*FEPAEAHRDSGEE 305 L+ P+R PRS+ STV V + P A D ++ Sbjct: 129 LQLRPIRLPRSVSSTVLGVIYHPPHAKADDNQK 161 >SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 27.9 bits (59), Expect = 8.1 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = +1 Query: 226 EDPEVFIRRYEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENF 378 EDP+ IRRYE S + E+ K L +A E +E +FL E F Sbjct: 109 EDPDYVIRRYE---SGRYASDESVRKEYLKVDEAKEELQEVVEFLRNPEKF 156 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,104,595 Number of Sequences: 59808 Number of extensions: 462904 Number of successful extensions: 1408 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1397 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -