BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0829 (688 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 32 0.41 At2g02720.1 68415.m00214 pectate lyase family protein similar to... 31 0.72 At4g36520.1 68417.m05185 trichohyalin-related low similarity to ... 31 0.95 At2g17410.1 68415.m02009 ARID/BRIGHT DNA-binding domain-containi... 30 1.7 At1g51900.1 68414.m05850 hypothetical protein 30 1.7 At3g47180.1 68416.m05123 zinc finger (C3HC4-type RING finger) fa... 29 2.2 At5g64420.1 68418.m08092 DNA polymerase V family contains Pfam d... 29 2.9 At3g28770.1 68416.m03591 expressed protein 29 2.9 At1g23230.1 68414.m02906 expressed protein 29 3.8 At5g60500.1 68418.m07587 undecaprenyl pyrophosphate synthetase f... 28 5.0 At5g11110.1 68418.m01297 sucrose-phosphate synthase, putative si... 28 5.0 At3g57780.1 68416.m06436 expressed protein 28 5.0 At3g19840.1 68416.m02513 FF domain-containing protein / WW domai... 28 5.0 At3g43390.1 68416.m04592 hypothetical protein similar to At3g243... 28 6.7 At3g02320.1 68416.m00214 N2,N2-dimethylguanosine tRNA methyltran... 28 6.7 At4g05280.1 68417.m00799 Ulp1 protease family protein contains P... 27 8.8 At3g11385.1 68416.m01386 DC1 domain-containing protein contains ... 27 8.8 At1g49980.1 68414.m05609 UMUC-like DNA repair family protein low... 27 8.8 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 31.9 bits (69), Expect = 0.41 Identities = 31/127 (24%), Positives = 50/127 (39%), Gaps = 4/127 (3%) Frame = +3 Query: 15 LSARIFYPLPHQKYIDSQWPAP*VTLPP*KT----SPRSPQT*RVSSKASTPAVSVTSTP 182 ++ R+ P P + + S PA + PP + SP ++ +P+ S S P Sbjct: 456 VAQRLPSPPPRRAGLPSPPPAQRLPSPPPRRAGLPSPMRIGGSHAANHLESPSPSSLSPP 515 Query: 183 MKRLCFRLLKTSPLRRPRSLYSTVREV*FEPAEAHRDSGEEPASGQRCYRSGEGKEQIPE 362 ++ ++L + P+RR RSL V H G G GK Sbjct: 516 GRK---KVLPSPPVRRRRSLTPDEERVSLSQGGRHTSPSHIKQDGSMSPVRGRGKSSPSS 572 Query: 363 RHRELRS 383 RH++ RS Sbjct: 573 RHQKARS 579 >At2g02720.1 68415.m00214 pectate lyase family protein similar to pectate lyase P59 SP:P15722 from [Lycopersicon esculentum] Length = 455 Score = 31.1 bits (67), Expect = 0.72 Identities = 17/58 (29%), Positives = 24/58 (41%) Frame = +1 Query: 280 KHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDVIEQE 453 K +E P P+ + + EK+ FLNG K KNP+P K I + Sbjct: 375 KQVTKREYTPYPEWKSWNWQSEKDYFLNGAYFVQSGKANAWSATPKNPIPRKFAIRPQ 432 >At4g36520.1 68417.m05185 trichohyalin-related low similarity to SP|Q07283 Trichohyalin {Homo sapiens} Length = 1400 Score = 30.7 bits (66), Expect = 0.95 Identities = 18/78 (23%), Positives = 34/78 (43%), Gaps = 1/78 (1%) Frame = +1 Query: 274 QLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFD-PTKLKHTETCEKNPLPTKDVIEQ 450 Q+K + +E+N K+ +E + + K +E + +LK T E+N ++ IE Sbjct: 778 QIKERQEREENERRAKEVLEQAENERKLKEALEQKENERRLKETREKEENKKKLREAIEL 837 Query: 451 EKSAXXXXXXXXXANVSR 504 E+ A + R Sbjct: 838 EEKEKRLIEAFERAEIER 855 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/68 (23%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Frame = +1 Query: 256 EKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFD-PTKLKHTETCEKNPLPT 432 +K + +LK T +E+N ++AIE E+++ + + E + +LK E+ + Sbjct: 811 QKENERRLKETREKEENKKKLREAIELEEKEKRLIEAFERAEIERRLKEDLEQEEMRMRL 870 Query: 433 KDVIEQEK 456 ++ E+E+ Sbjct: 871 QEAKERER 878 >At2g17410.1 68415.m02009 ARID/BRIGHT DNA-binding domain-containing protein contains Pfam profile PF01388: ARID/BRIGHT DNA binding domain Length = 786 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 3/62 (4%) Frame = +2 Query: 65 TMACSVSDTPSLKDLPKVATDLKSQLEGF---NTSCLRDVDTNEKIVLPSAEDVATEKTQ 235 T S+ + + DLPK+ + SQ E + S +DT E ++ P+AED E Sbjct: 74 TSLASLEEVTNADDLPKIDDEKNSQFETSPHPSPSPSVALDTEEGLINPTAEDTVEENIV 133 Query: 236 KS 241 S Sbjct: 134 SS 135 >At1g51900.1 68414.m05850 hypothetical protein Length = 774 Score = 29.9 bits (64), Expect = 1.7 Identities = 22/76 (28%), Positives = 37/76 (48%) Frame = +1 Query: 229 DPEVFIRRYEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTET 408 DP+++IR YE+ + K + T + + + D+IE K + L+ I LK + Sbjct: 362 DPDIYIRSYEESPNEVYKFSLTDLEEEIMENDSIEG--VKCRMLDEIMKKSGHHLKISRP 419 Query: 409 CEKNPLPTKDVIEQEK 456 E P K V E+E+ Sbjct: 420 -EYKPEIEKQVYEEEE 434 >At3g47180.1 68416.m05123 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 210 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = +1 Query: 226 EDPEVFIRRYEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTE 405 ++ E+ YE FDS+ E + L D+++ +E++ FL + DP +L + E Sbjct: 62 DEEEINENYYEYFDSNGFGVDEDEINEFLEDQESNSNLEEEDDFLEEEDEIDPDQLSYEE 121 >At5g64420.1 68418.m08092 DNA polymerase V family contains Pfam domain PF04931: DNA polymerase V Length = 1306 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +1 Query: 286 TETQEKNPLPDKDAIEAEKEKNKFLNGIENFD 381 TE E + LPD ++ +K K + +N + N+D Sbjct: 12 TELVENDNLPDSSIVKKKKSKTEKMNTVANYD 43 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 29.1 bits (62), Expect = 2.9 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Frame = +1 Query: 244 IRRYEKFDSSQLKHTETQEKNPLPD-KDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKN 420 +R E+ K +E EK + KDA E + NK L+ EN D K + E +++ Sbjct: 768 VRNKEENVQGNKKESEKVEKGEKKESKDAKSVETKDNKKLSSTENRDEAKERSGEDNKED 827 Query: 421 PLPTKD 438 +KD Sbjct: 828 KEESKD 833 >At1g23230.1 68414.m02906 expressed protein Length = 1615 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 436 PLWGAGSSRTFPCASA*WDRSSRC-RSGICSFPSP 335 PL+G + + P S W+R+ RC R I + PSP Sbjct: 393 PLYGEDLAMSIPKGSLDWERAVRCIRHAIRTTPSP 427 >At5g60500.1 68418.m07587 undecaprenyl pyrophosphate synthetase family protein / UPP synthetase family protein contains putative undecaprenyl diphosphate synthase domain [PF01255]; similar to S. cerevisiae dehydrodolichyl diphosphate synthetase (DEDOL-PP synthase)(Rer2)[SP|P35196], a cis-prenyltransferase Length = 271 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -1 Query: 229 LLSGDVFSRRKHNLFIGVDVTETAGVEAFELTLQVCGDLG 110 ++ G+ +KHNL IG+D AG + + LQ C ++G Sbjct: 41 IMDGNRRFAKKHNL-IGLDAGHRAGFISVKYILQYCKEIG 79 >At5g11110.1 68418.m01297 sucrose-phosphate synthase, putative similar to sucrose-phosphate synthase isoform 1, Citrus unshiu, PIR:S72648 Length = 894 Score = 28.3 bits (60), Expect = 5.0 Identities = 23/74 (31%), Positives = 36/74 (48%) Frame = +2 Query: 8 RVAECTNLLSPSSSKIY*FTMACSVSDTPSLKDLPKVATDLKSQLEGFNTSCLRDVDTNE 187 R+A C P ++ F + S S + SL+D+ ++ +LK L+G + VDTN Sbjct: 513 RIASCKQR-HPKWQRVE-FENSDSDSPSDSLRDINDISLNLKLSLDGEKSGSNNGVDTN- 569 Query: 188 KIVLPSAEDVATEK 229 AED A E+ Sbjct: 570 ----LDAEDRAAER 579 >At3g57780.1 68416.m06436 expressed protein Length = 670 Score = 28.3 bits (60), Expect = 5.0 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 265 DSSQLKHTETQEK-NPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCE 414 DSS+ TE +E N L D E EKE++K L+ I + + ETCE Sbjct: 72 DSSE--KTEKEETINGLACDDEDEEEKEESKELDAIAHEKTDSVSSPETCE 120 >At3g19840.1 68416.m02513 FF domain-containing protein / WW domain-containing protein weak similarity to transcription factor CA150b [Mus musculus] GI:6329166; contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 743 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/60 (26%), Positives = 26/60 (43%) Frame = +3 Query: 294 SGEEPASGQRCYRSGEGKEQIPERHRELRSH*AEAHGNVREEPAPHKGRH*AREISLNHY 473 S E+ A R + + K + ER + SH ++ ++R EP H RE+ Y Sbjct: 489 SAEQKAQEIRAAAASDFKTMLREREISINSHWSKVKDSLRNEPRYRSVAHEDREVFYYEY 548 >At3g43390.1 68416.m04592 hypothetical protein similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At4g05280, At1g25886, At4g03300 Length = 1113 Score = 27.9 bits (59), Expect = 6.7 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = +1 Query: 274 QLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDVIEQE 453 QL+ T+ + K P E +K K D K ++ E C P+P + ++E Sbjct: 413 QLEETDVKRKRNAPGPSPKEPAMKKQK-----SEMDCDKEENAEDCFGEPVPERFIVEMR 467 Query: 454 KS 459 +S Sbjct: 468 RS 469 >At3g02320.1 68416.m00214 N2,N2-dimethylguanosine tRNA methyltransferase family protein similar to N2,N2-dimethylguanosine tRNA methyltransferase [Homo sapiens] GI:11066198; contains Pfam profile PF02005: N2,N2-dimethylguanosine tRNA methyltransferase Length = 599 Score = 27.9 bits (59), Expect = 6.7 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 235 EVFIRRYEKFDSSQLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFD 381 E +R ++ ++ K T K + +KDA EA KE+ NG+ N D Sbjct: 45 EFLSKRKQEHEAKSSKRTRPASK--VIEKDASEASKEETPSENGMNNGD 91 >At4g05280.1 68417.m00799 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At3g24380, At5g36840, At5g35010, At3g42740, At4g05290, At2g14770, At3g43390, At2g05560, At4g08880, At1g34730, At1g27790, At1g34740, At1g27780, At5g36850, At3g42730, At1g52020, At3g24390, At1g25886, At4g03300 Length = 1312 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = +1 Query: 274 QLKHTETQEKNPLPDKDAIEAEKEKNKFLNGIENFDPTKLKHTETCEKNPLPTKDVIEQE 453 QL+ T+ + K P E +K I D K ++ E C P+P + ++E Sbjct: 359 QLEETDVKRKRNAPGPSPKEPAMKKQ-----ISEMDCDKEENAEDCFGEPVPERFIVEMR 413 Query: 454 KS 459 +S Sbjct: 414 RS 415 >At3g11385.1 68416.m01386 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 766 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 593 HCLGQWATYSNPGFYFKFPNDKSRLTAN 676 HCL ++Y PGF FK+ + K + N Sbjct: 694 HCLFGSSSYMKPGFRFKYYSSKVEVRRN 721 >At1g49980.1 68414.m05609 UMUC-like DNA repair family protein low similarity to DNA polymerase kappa [Mus musculus] GI:14279087; contains Pfam profile PF00817: ImpB/MucB/SamB family Length = 785 Score = 27.5 bits (58), Expect = 8.8 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = -1 Query: 232 GLLSGDVFSRRKHNLFIGVDVTETAGVEAFELTLQVCGDLGE 107 GL G++ + +++ +T +AGV A L +VC D+ + Sbjct: 214 GLSGGEIAEELRSSVYSETGLTCSAGVAANRLLAKVCSDINK 255 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,630,774 Number of Sequences: 28952 Number of extensions: 316064 Number of successful extensions: 980 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 937 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 980 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1457719448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -