BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0828 (728 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pom... 29 0.90 SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomy... 25 8.4 >SPAC144.05 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1375 Score = 28.7 bits (61), Expect = 0.90 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = +2 Query: 419 SSKTKVAQKIY----FRCKLDPTIIVMMKTDDENGMLFIIRYSP 538 +S++ VAQ IY C V + DD G+LF++RYSP Sbjct: 434 TSQSNVAQMIYRIPRVNCWTVSGTPVRSEVDDLFGLLFLLRYSP 477 >SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 25.4 bits (53), Expect = 8.4 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -2 Query: 316 ISQVNFMDILLSHFNLLYHRPIPRVLKFNFY*INFRLGLKF 194 I+ N++D LL +L+Y PRV F ++ + F+ G F Sbjct: 305 INFFNYVDYLLVP-SLVYSMEFPRVAHFRWHYMAFKAGSTF 344 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,900,900 Number of Sequences: 5004 Number of extensions: 58645 Number of successful extensions: 103 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -