BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0828 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 23 9.7 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 23 9.7 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 23 9.7 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 23 9.7 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 23 9.7 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 23.0 bits (47), Expect = 9.7 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +1 Query: 376 LNSTSF-NIITICVTKLQDQGGPKNIFSMQIRS 471 LNS F + I ICVT + + G + F +RS Sbjct: 433 LNSLQFPSGIHICVTYMHTEAGVADKFIQDVRS 465 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.0 bits (47), Expect = 9.7 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 419 LVTQIVIMLKLVEFNF*IESWTSRAAACL 333 L+TQ+ ++ KL +FN+ I +R ACL Sbjct: 50 LMTQVTLIYKLEKFNYNI----ARIQACL 74 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.0 bits (47), Expect = 9.7 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 419 LVTQIVIMLKLVEFNF*IESWTSRAAACL 333 L+TQ+ ++ KL +FN+ I +R ACL Sbjct: 50 LMTQVTLIYKLEKFNYNI----ARIQACL 74 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.0 bits (47), Expect = 9.7 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 419 LVTQIVIMLKLVEFNF*IESWTSRAAACL 333 L+TQ+ ++ KL +FN+ I +R ACL Sbjct: 50 LMTQVTLIYKLEKFNYNI----ARIQACL 74 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 23.0 bits (47), Expect = 9.7 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 419 LVTQIVIMLKLVEFNF*IESWTSRAAACL 333 L+TQ+ ++ KL +FN+ I +R ACL Sbjct: 84 LMTQVTLIYKLEKFNYNI----ARIQACL 108 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 740,486 Number of Sequences: 2352 Number of extensions: 15398 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -