BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0828 (728 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003390-1|AAB54271.2| 473|Caenorhabditis elegans Hypothetical ... 29 2.6 >AF003390-1|AAB54271.2| 473|Caenorhabditis elegans Hypothetical protein R155.1a protein. Length = 473 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -2 Query: 505 FIISFHHNDNSWI*FASKIYFLGHLGLGAWLHK 407 FI +F ++ I +A+ I FLGHL +G W H+ Sbjct: 78 FITNFMAGTDASI-YAAHIVFLGHLLIGYWFHE 109 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,977,168 Number of Sequences: 27780 Number of extensions: 327207 Number of successful extensions: 596 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 596 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1718929214 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -