BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0827 (561 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosacc... 26 3.3 SPBC21.01 |mis17|SPBC776.19|kinetochore protein Mis17|Schizosacc... 26 3.3 SPBC14C8.15 |||triglyceride lipase-cholesterol esterase |Schizos... 26 4.4 SPBC1677.03c |||threonine ammonia-lyase|Schizosaccharomyces pomb... 25 5.8 >SPAC6G9.04 |mug79||meiotically upregulated gene Mug79|Schizosaccharomyces pombe|chr 1|||Manual Length = 1318 Score = 26.2 bits (55), Expect = 3.3 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -2 Query: 98 LERAFRFHWTQNRRSRFRFLKIYFLDWQHL 9 L + + HW + +++R F K+ F W +L Sbjct: 881 LSKEDKKHWLKYKKNRSTFAKLLFSTWSNL 910 >SPBC21.01 |mis17|SPBC776.19|kinetochore protein Mis17|Schizosaccharomyces pombe|chr 2|||Manual Length = 441 Score = 26.2 bits (55), Expect = 3.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 252 LDSLKRKMEPESPSNITGTSF 314 LDS + + E P N+TGT+F Sbjct: 177 LDSSQDSFQEEHPGNVTGTTF 197 >SPBC14C8.15 |||triglyceride lipase-cholesterol esterase |Schizosaccharomyces pombe|chr 2|||Manual Length = 460 Score = 25.8 bits (54), Expect = 4.4 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 3/77 (3%) Frame = +1 Query: 331 FRKLSEFRFRFTFQQTG---G*GTCIIVLPHPYTKPDINCFLEVCKVLRKKFEVSIKFYN 501 F K+ + RF TG I+ H Y+ + CF+ ++ R+K ++ Y+ Sbjct: 290 FAKIVDLFLRFFLSWTGKNISETQKIVAYSHLYSFTSVKCFVHWAQITRRKV---LQMYD 346 Query: 502 GYLIFKPESIADSYNRI 552 FKP S + NRI Sbjct: 347 DSPGFKP-SYYTNLNRI 362 >SPBC1677.03c |||threonine ammonia-lyase|Schizosaccharomyces pombe|chr 2|||Manual Length = 600 Score = 25.4 bits (53), Expect = 5.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 227 LLRGIRPYSGQFET*NGTGEPLEYNW 304 +L G+R + GQ E + E + YNW Sbjct: 560 VLAGLRVFDGQVEKLHSVLEEIGYNW 585 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,187,193 Number of Sequences: 5004 Number of extensions: 42108 Number of successful extensions: 112 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 236012634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -