BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0827 (561 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36313| Best HMM Match : Crl (HMM E-Value=5.1) 27 7.9 SB_8166| Best HMM Match : DUF729 (HMM E-Value=1.6) 27 7.9 SB_20569| Best HMM Match : LRR_1 (HMM E-Value=1.1e-27) 27 7.9 SB_16524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_36313| Best HMM Match : Crl (HMM E-Value=5.1) Length = 442 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -2 Query: 344 LSFLNPCLASETCASYIRGALRFHFTFQTVQNMVE 240 +S NP A T S IRG LRFH F T + + E Sbjct: 394 VSLTNPAFA--TLPSVIRGFLRFHVYFTTRRILYE 426 >SB_8166| Best HMM Match : DUF729 (HMM E-Value=1.6) Length = 327 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -2 Query: 344 LSFLNPCLASETCASYIRGALRFHFTFQTVQNMVE 240 +S NP A T S IRG LRFH F T + + E Sbjct: 279 VSLTNPAFA--TLPSVIRGFLRFHVYFTTRRILYE 311 >SB_20569| Best HMM Match : LRR_1 (HMM E-Value=1.1e-27) Length = 309 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 348 FTQFPESLFGVRNLCQLYSRGSPVPFYVSNCPE 250 F +FPE+L G+ +L L RG+ + NC E Sbjct: 218 FEEFPENLIGLVSLECLSLRGNCIKSLADNCVE 250 >SB_16524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -2 Query: 344 LSFLNPCLASETCASYIRGALRFHFTFQTVQNMVE 240 +S NP A T S IRG LRFH F T + + E Sbjct: 381 VSLTNPAFA--TLPSVIRGFLRFHVYFTTRRILYE 413 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,563,073 Number of Sequences: 59808 Number of extensions: 286505 Number of successful extensions: 850 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 788 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 850 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -