BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0827 (561 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M22874-2|AAA28675.1| 916|Drosophila melanogaster protein ( D.me... 30 1.9 BT024937-1|ABE01167.1| 575|Drosophila melanogaster IP16068p pro... 28 9.9 AY129450-1|AAM76192.1| 979|Drosophila melanogaster LD36241p pro... 28 9.9 AY058622-1|AAL13851.1| 977|Drosophila melanogaster LD31525p pro... 28 9.9 AE014298-795|AAF46081.1| 507|Drosophila melanogaster CG15769-PA... 28 9.9 AE014296-1278|AAF50545.3| 1166|Drosophila melanogaster CG7546-PB... 28 9.9 AE014296-1277|AAF50546.2| 1332|Drosophila melanogaster CG7546-PA... 28 9.9 >M22874-2|AAA28675.1| 916|Drosophila melanogaster protein ( D.melanogaster LINEelement J-1, clone J-1. ). Length = 916 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/44 (31%), Positives = 27/44 (61%) Frame = +2 Query: 194 WXSPSKMPQIRLLRGIRPYSGQFET*NGTGEPLEYNWHKFLTPN 325 W +P P+ ++L+ + + GQ++ TGEP Y+++ LTP+ Sbjct: 146 WGNPRSCPRGKMLQEVIAH-GQYQV-LATGEPTFYSYNPLLTPS 187 >BT024937-1|ABE01167.1| 575|Drosophila melanogaster IP16068p protein. Length = 575 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 388 GTCIIVLPHPYTKPDINCFLEVCKVLRKKFEVSIKFYNG 504 G ++ LP Y +P+ N VC +LR + I+ NG Sbjct: 260 GESLVYLPQ-YERPEYNSRDSVCNILRVSLRLIIELCNG 297 >AY129450-1|AAM76192.1| 979|Drosophila melanogaster LD36241p protein. Length = 979 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 388 GTCIIVLPHPYTKPDINCFLEVCKVLRKKFEVSIKFYNG 504 G ++ LP Y +P+ N VC +LR + I+ NG Sbjct: 665 GESLVYLPQ-YERPEYNSRDSVCNILRVSLRLIIELCNG 702 >AY058622-1|AAL13851.1| 977|Drosophila melanogaster LD31525p protein. Length = 977 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 388 GTCIIVLPHPYTKPDINCFLEVCKVLRKKFEVSIKFYNG 504 G ++ LP Y +P+ N VC +LR + I+ NG Sbjct: 662 GESLVYLPQ-YERPEYNSRDSVCNILRVSLRLIIELCNG 699 >AE014298-795|AAF46081.1| 507|Drosophila melanogaster CG15769-PA protein. Length = 507 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +2 Query: 176 YIGAA*WXSPSKMPQIRLLRGIRPYSGQFET*NGTGEPLEYNW 304 Y GA + P L G+R Y G + + G G+ + Y W Sbjct: 365 YRGAHSFSEPESRAVCSFLSGMREYLGAYVSLGGYGQAITYPW 407 >AE014296-1278|AAF50545.3| 1166|Drosophila melanogaster CG7546-PB, isoform B protein. Length = 1166 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 388 GTCIIVLPHPYTKPDINCFLEVCKVLRKKFEVSIKFYNG 504 G ++ LP Y +P+ N VC +LR + I+ NG Sbjct: 851 GESLVYLPQ-YERPEYNSRDSVCNILRVSLRLIIELCNG 888 >AE014296-1277|AAF50546.2| 1332|Drosophila melanogaster CG7546-PA, isoform A protein. Length = 1332 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 388 GTCIIVLPHPYTKPDINCFLEVCKVLRKKFEVSIKFYNG 504 G ++ LP Y +P+ N VC +LR + I+ NG Sbjct: 1017 GESLVYLPQ-YERPEYNSRDSVCNILRVSLRLIIELCNG 1054 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,757,238 Number of Sequences: 53049 Number of extensions: 429485 Number of successful extensions: 1058 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2172596895 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -