BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0826 (528 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0650 - 4701939-4702224,4702513-4702604,4703022-4703049,470... 75 4e-14 03_02_0755 + 10932897-10933010,10933446-10933577,10933666-109337... 54 9e-08 07_01_0481 - 3621798-3621926,3622572-3622660,3622780-3622933,362... 39 0.002 07_03_1012 + 23295976-23296264,23296475-23296548,23296972-232969... 38 0.004 03_06_0260 - 32717142-32717270,32717743-32717831,32717950-327180... 36 0.015 09_02_0285 + 6894899-6895114,6896197-6896422,6896889-6896992,689... 36 0.020 01_07_0028 - 40588611-40588718,40588812-40588901,40589966-405901... 36 0.020 02_02_0339 + 9115297-9115366,9116280-9116407,9117537-9117641,911... 36 0.027 06_03_0198 - 17797574-17797717,17797995-17798099,17798509-177986... 35 0.035 02_01_0154 + 1078561-1078630,1078758-1078885,1079016-1079120,107... 35 0.035 01_06_1150 + 34910941-34911010,34911611-34911738,34912025-349121... 35 0.035 01_06_0129 - 26770543-26770720,26774592-26774719,26774829-267749... 35 0.046 01_01_1187 + 9444742-9445317 35 0.046 02_05_0555 - 29937973-29938395,29938509-29938790 34 0.081 10_02_0166 - 6065088-6065093,6066671-6068544,6068643-6069548,606... 33 0.11 04_04_1516 - 34122205-34122348,34122430-34122534,34122878-341230... 33 0.11 10_02_0129 + 5584585-5584732,5586567-5586968,5587038-5587106,558... 33 0.19 05_05_0110 + 22470869-22470920,22471044-22471146,22473261-224733... 33 0.19 01_06_0222 - 27662122-27662159,27662251-27662341,27662760-276628... 33 0.19 06_03_1005 + 26837047-26837093,26837644-26837731,26837854-268379... 32 0.25 02_05_0556 - 29940146-29940158,29941060-29941240,29941271-29941670 32 0.25 01_05_0633 + 23840427-23840562,23840699-23840768,23840846-238409... 32 0.33 01_06_1289 - 36010924-36011001,36011441-36011518,36012321-360124... 31 0.57 12_02_1249 - 27331801-27331896,27331984-27332072,27334020-273340... 31 0.76 04_01_0188 - 2208001-2208576,2211502-2211513,2212837-2212970,221... 30 1.0 02_01_0246 + 1617326-1617367,1618903-1624419,1625040-1625498,162... 30 1.3 05_07_0076 - 27520152-27520379,27520785-27521096,27521194-275213... 29 2.3 10_05_0119 + 9351951-9352047,9352336-9352361,9353555-9353791,935... 28 4.0 09_02_0290 - 6963673-6963966,6964279-6964590,6964693-6964832,696... 28 4.0 01_01_0939 - 7404209-7404490,7405057-7405368,7405470-7405609,740... 28 4.0 01_01_0167 + 1422344-1424260,1424338-1424472,1424568-1424990,142... 28 4.0 10_08_0755 - 20329127-20329189,20329276-20329389,20329465-203296... 28 5.3 09_02_0309 - 7151297-7151437,7151532-7151657,7152068-7152217 28 5.3 01_01_0928 + 7339796-7339806,7339923-7340043,7340463-7340549,734... 28 5.3 10_08_0197 + 15666873-15666916,15667098-15667177,15667490-156676... 27 7.1 >06_01_0650 - 4701939-4702224,4702513-4702604,4703022-4703049, 4703440-4703479,4703611-4703672,4703864-4703927, 4704043-4704081,4705571-4705625,4705730-4705786 Length = 240 Score = 74.9 bits (176), Expect = 4e-14 Identities = 30/57 (52%), Positives = 45/57 (78%) Frame = +3 Query: 357 QFKTNTRLCLSITDFHPDTWNPAWSISTILTGLLSFMLEKTPTLGSIETSRYQKRCL 527 +F + R+CLS++DFHP++WNP WS+++ILTGLLSFM++ T GSI ++ +KR L Sbjct: 79 RFAPHKRICLSMSDFHPESWNPMWSVASILTGLLSFMMDDALTTGSIRSTEGEKRRL 135 Score = 56.8 bits (131), Expect = 1e-08 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSIYMITPNG 357 +P+EGGYY+GK+ FP ++PFKPPSI M TP+G Sbjct: 47 TPFEGGYYYGKLKFPPDYPFKPPSISMTTPSG 78 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/47 (40%), Positives = 31/47 (65%) Frame = +2 Query: 137 GATSRLKQDYLRLKNDPVPYVTAEPVPSNILEWHYVVKGRRKVPTKG 277 G RL+++Y L +P P + A P+P++ILEWH+V++G P +G Sbjct: 5 GCLKRLQKEYHSLCKEPPPQIVARPLPNDILEWHFVLEGSAGTPFEG 51 >03_02_0755 + 10932897-10933010,10933446-10933577,10933666-10933750, 10934668-10934831,10934911-10935357 Length = 313 Score = 53.6 bits (123), Expect = 9e-08 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 3/60 (5%) Frame = +3 Query: 357 QFKTNTRLCLSITDFHPDTWNPAWSISTILTGLLSFMLEKTP---TLGSIETSRYQKRCL 527 +F+ ++CLSI+++HP+ W P+WS+ T L L++FM TP LGS++ + +R L Sbjct: 86 RFEIQKKICLSISNYHPEHWQPSWSVRTALVALIAFM--PTPGGGALGSLDFKKEDRRAL 143 Score = 50.8 bits (116), Expect = 7e-07 Identities = 21/44 (47%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSIYMITPNGSSR-QTHDCASV 390 S +EGG YHG+I P ++PFKPPS ++TP+G Q C S+ Sbjct: 54 SEFEGGIYHGRIQLPSDYPFKPPSFMLLTPSGRFEIQKKICLSI 97 Score = 33.9 bits (74), Expect = 0.081 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +2 Query: 140 ATSRLKQDYLRLKNDPVPYVTAEPVPSNILEWHYVVKGRRKVPTKGDIIMERL 298 A R+ Q+ ++++P P A P+ +I EW + + G R +G I R+ Sbjct: 13 AVKRILQEVKEMQSNPSPDFMAMPLEEDIFEWQFAILGPRDSEFEGGIYHGRI 65 >07_01_0481 - 3621798-3621926,3622572-3622660,3622780-3622933, 3624104-3624111,3625522-3625547,3625757-3625881 Length = 176 Score = 39.1 bits (87), Expect = 0.002 Identities = 21/63 (33%), Positives = 32/63 (50%) Frame = +2 Query: 134 TGATSRLKQDYLRLKNDPVPYVTAEPVPSNILEWHYVVKGRRKVPTKGDIIMERLFSQGN 313 T A RL +D+ RL+ DP ++ P +NI+ W+ V+ G P G + + GN Sbjct: 3 TPARKRLMRDFKRLQQDPPAGISGAPHDNNIMLWNAVIFGPDDTPWDGGFSLP-VCQHGN 61 Query: 314 FRS 322 RS Sbjct: 62 LRS 64 >07_03_1012 + 23295976-23296264,23296475-23296548,23296972-23296996, 23297486-23297568,23297653-23297685,23298322-23298469, 23298625-23298722 Length = 249 Score = 38.3 bits (85), Expect = 0.004 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPP 330 SPYEGG + I+FP ++PFKPP Sbjct: 98 SPYEGGIFFLDIVFPIDYPFKPP 120 >03_06_0260 - 32717142-32717270,32717743-32717831,32717950-32718039, 32721571-32721596,32721772-32721896 Length = 152 Score = 36.3 bits (80), Expect = 0.015 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +2 Query: 134 TGATSRLKQDYLRLKNDPVPYVTAEPVPSNILEWHYVVKGRRKVPTKG 277 T A RL +D+ RL+ DP ++ P +NI+ W+ V+ G P G Sbjct: 3 TPARKRLMRDFKRLQQDPPAGISGAPHDNNIMLWNAVIFGPDDTPWDG 50 >09_02_0285 + 6894899-6895114,6896197-6896422,6896889-6896992, 6897121-6897239,6897445-6897634 Length = 284 Score = 35.9 bits (79), Expect = 0.020 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSI 336 SPY GG + I FP ++PFKPP + Sbjct: 43 SPYAGGVFFVNIHFPPDYPFKPPKV 67 >01_07_0028 - 40588611-40588718,40588812-40588901,40589966-40590125, 40590547-40590595,40591158-40591338 Length = 195 Score = 35.9 bits (79), Expect = 0.020 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSIYMIT----PNGSSRQTHDCASVLQ 396 +PYEGG + I P +PF+PP + IT PN SS+ C +L+ Sbjct: 46 TPYEGGTFVIDIRLPGGYPFEPPKMQFITKVWHPNISSQNGAICLDILK 94 >02_02_0339 + 9115297-9115366,9116280-9116407,9117537-9117641, 9118165-9118259,9119472-9119538,9119685-9119720 Length = 166 Score = 35.5 bits (78), Expect = 0.027 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSIYMIT 348 SPY GG + I FP ++PFKPP + + T Sbjct: 43 SPYAGGVFLVTIHFPPDYPFKPPKVALKT 71 >06_03_0198 - 17797574-17797717,17797995-17798099,17798509-17798636, 17799444-17799513 Length = 148 Score = 35.1 bits (77), Expect = 0.035 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSI 336 SPY GG + I FP ++PFKPP + Sbjct: 43 SPYAGGVFLVSIHFPPDYPFKPPKV 67 >02_01_0154 + 1078561-1078630,1078758-1078885,1079016-1079120, 1079228-1079371 Length = 148 Score = 35.1 bits (77), Expect = 0.035 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSI 336 SPY GG + I FP ++PFKPP + Sbjct: 43 SPYSGGVFLVTIHFPPDYPFKPPKV 67 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 366 TNTRLCLSITDFHPDTWNPAWSISTILTGLLSFMLEKTP 482 +N +CL I D W+PA +IS +L + S + + P Sbjct: 80 SNGNICLDILK---DQWSPALTISKVLLSICSLLTDPNP 115 >01_06_1150 + 34910941-34911010,34911611-34911738,34912025-34912129, 34912525-34912668 Length = 148 Score = 35.1 bits (77), Expect = 0.035 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSI 336 SPY GG + I FP ++PFKPP + Sbjct: 43 SPYAGGVFLVNIHFPPDYPFKPPKV 67 >01_06_0129 - 26770543-26770720,26774592-26774719,26774829-26774933, 26775661-26775788,26777332-26777433,26778760-26778861, 26779777-26779852,26779971-26780059,26780177-26780230, 26780482-26780614,26780671-26780797,26781590-26781648 Length = 426 Score = 34.7 bits (76), Expect = 0.046 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSI 336 SPY GG + I FP ++PFKPP + Sbjct: 267 SPYAGGVFLVTIHFPPDYPFKPPKV 291 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +3 Query: 366 TNTRLCLSITDFHPDTWNPAWSISTILTGLLSFMLEKTP 482 +N +CL I D W+PA +IS +L + S + + P Sbjct: 304 SNGSICLDILK---DQWSPALTISKVLLSICSLLTDPNP 339 >01_01_1187 + 9444742-9445317 Length = 191 Score = 34.7 bits (76), Expect = 0.046 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 268 YEGGYYHGKIIFPREFPFKPPSIYMITP 351 YEG Y + FP E+P+KPP + TP Sbjct: 91 YEGTSYRLSLAFPGEYPYKPPKVRFETP 118 >02_05_0555 - 29937973-29938395,29938509-29938790 Length = 234 Score = 33.9 bits (74), Expect = 0.081 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSIYMIT 348 +PY GG + + FP ++PF+PP ++ T Sbjct: 65 TPYAGGVFPVDVWFPYDYPFRPPKLFFKT 93 >10_02_0166 - 6065088-6065093,6066671-6068544,6068643-6069548, 6069623-6069676,6069751-6069808 Length = 965 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +3 Query: 273 RGILSWKDYFPK-GISVQTTFDLHDNTEWQFKTNTRLCLSITDFH 404 +G L W PK G+S++ N +N+RLC+S+ D++ Sbjct: 309 KGELGWHPEIPKVGVSIEDVIASRGNNHADSDSNSRLCVSVRDYY 353 >04_04_1516 - 34122205-34122348,34122430-34122534,34122878-34123005, 34124003-34124072 Length = 148 Score = 33.5 bits (73), Expect = 0.11 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSI 336 SP+ GG + I FP ++PFKPP + Sbjct: 43 SPFAGGVFLVNIHFPPDYPFKPPKV 67 >10_02_0129 + 5584585-5584732,5586567-5586968,5587038-5587106, 5587181-5587234,5587309-5588214,5588313-5590283, 5590833-5591235,5591845-5591857 Length = 1321 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +3 Query: 273 RGILSWKDYFPK-GISVQTTFDLHDNTEWQFKTNTRLCLSITDFH 404 +G L W PK G+S+ N +N+RLC+S+ D++ Sbjct: 496 KGELGWHPEIPKVGVSIDDVIASRGNNHADSDSNSRLCVSVRDYY 540 >05_05_0110 + 22470869-22470920,22471044-22471146,22473261-22473358, 22473430-22473530,22474052-22474129,22474578-22474655 Length = 169 Score = 32.7 bits (71), Expect = 0.19 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +1 Query: 268 YEGGYYHGKIIFPREFPFKPPSI 336 Y+GGY++ + FP+ +P PPS+ Sbjct: 52 YDGGYFNAIMTFPQNYPNSPPSV 74 >01_06_0222 - 27662122-27662159,27662251-27662341,27662760-27662801, 27663591-27663649,27664300-27664386,27664501-27664528, 27664683-27664718 Length = 126 Score = 32.7 bits (71), Expect = 0.19 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 259 KSPYEGGYYHGKIIFPREFPFKPPSIYMIT 348 +SPYEGG + ++ P E+P P + +T Sbjct: 46 QSPYEGGVFKLELFLPEEYPMAAPKVRFLT 75 >06_03_1005 + 26837047-26837093,26837644-26837731,26837854-26837998, 26838150-26838227,26838323-26838435,26838538-26838641, 26838804-26839119 Length = 296 Score = 32.3 bits (70), Expect = 0.25 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSIYMIT 348 +PYE G + K++ R+FP PP + +T Sbjct: 96 TPYENGVFRMKLLLSRDFPQSPPKGFFLT 124 >02_05_0556 - 29940146-29940158,29941060-29941240,29941271-29941670 Length = 197 Score = 32.3 bits (70), Expect = 0.25 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSIYMITPNGSSRQT 372 +PY GG + + +P E+PF+PP + T S Q+ Sbjct: 78 TPYAGGTFPVDVWYPNEYPFQPPKLTFKTKVKSLAQS 114 >01_05_0633 + 23840427-23840562,23840699-23840768,23840846-23840951, 23841086-23841184,23841320-23841442,23841555-23842691 Length = 556 Score = 31.9 bits (69), Expect = 0.33 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 256 EKSPYEGGYYHGKIIFPREFPFKPPSIYMITP 351 +++ Y G + KI P +PF+PP++ +TP Sbjct: 51 DETVYSKGVFVLKIQIPERYPFQPPNVTFVTP 82 Score = 30.3 bits (65), Expect = 1.0 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +3 Query: 375 RLCLSITDFHPD-TWNPAWSISTILTGLLSFMLEKTPTLGSI-ETSRYQK 518 R+CL I + P W P+ +I+T+LT + + + P G + E SR K Sbjct: 93 RICLDILNLPPKGAWQPSLNIATVLTSIGLLLSDPNPDDGLMAEISREYK 142 >01_06_1289 - 36010924-36011001,36011441-36011518,36012321-36012421, 36012506-36012603,36016213-36016315,36016435-36016486 Length = 169 Score = 31.1 bits (67), Expect = 0.57 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +1 Query: 268 YEGGYYHGKIIFPREFPFKPPSI 336 Y+GGY++ + FP+ +P PP++ Sbjct: 52 YDGGYFNAIMSFPQNYPNSPPTV 74 >12_02_1249 - 27331801-27331896,27331984-27332072,27334020-27334083, 27334208-27334336,27334554-27334607,27334712-27334741 Length = 153 Score = 30.7 bits (66), Expect = 0.76 Identities = 14/53 (26%), Positives = 26/53 (49%) Frame = +3 Query: 366 TNTRLCLSITDFHPDTWNPAWSISTILTGLLSFMLEKTPTLGSIETSRYQKRC 524 +N +CL I D+W+PA ++S++ +LS + + RY + C Sbjct: 86 SNGHICLDILY---DSWSPAMTVSSVCISILSMLSSSPAKQRPQDNDRYVRNC 135 >04_01_0188 - 2208001-2208576,2211502-2211513,2212837-2212970, 2213147-2213262,2214844-2215075,2218483-2218548, 2219661-2219750,2221340-2221388 Length = 424 Score = 30.3 bits (65), Expect = 1.0 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +3 Query: 210 LCRPTYWNGITSLKGGEKSLRRGILSWKDYFPKGISVQTTFDLH 341 L + YW +TS GG + G+L ++ FP+GI + T+ D H Sbjct: 122 LPKDQYWGYVTS--GGTEGNMHGLLVGRELFPEGI-IYTSCDSH 162 >02_01_0246 + 1617326-1617367,1618903-1624419,1625040-1625498, 1625603-1625887,1626016-1626030,1626339-1626419, 1626909-1627322,1627423-1627719,1627801-1629864 Length = 3057 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 104 IHVNMAKTKVTGATSRLKQDYL--RLKNDPVPYVTAEPVPSNILE 232 +H N K V TS + D + ++N+ V YVT EP ++ LE Sbjct: 2072 VHENTEKDAVVEKTSSSEHDEIAGEIRNEEVTYVTVEPCLASSLE 2116 >05_07_0076 - 27520152-27520379,27520785-27521096,27521194-27521333, 27521893-27521956,27522071-27522277,27522350-27522493, 27522578-27522709,27522880-27524294,27524647-27524920, 27526096-27526129,27527028-27527059 Length = 993 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 253 AEKSPYEGGYYHGKIIFPREFPFKPPSIY 339 A +PY + I FP ++P +PPS++ Sbjct: 789 AAGTPYHDNLFFFDIFFPPDYPHEPPSVH 817 >10_05_0119 + 9351951-9352047,9352336-9352361,9353555-9353791, 9355042-9355344 Length = 220 Score = 28.3 bits (60), Expect = 4.0 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -3 Query: 250 FNDVMPFQYV-GRHRFGRNIWYWVILEPQIILLQSASGSCHLCF 122 F D++ FQ V + F + W W+ L +IL+ + SG CF Sbjct: 172 FWDLVAFQAVIDQWLFRMSFWEWISLNFSVILIFNRSGELGDCF 215 >09_02_0290 - 6963673-6963966,6964279-6964590,6964693-6964832, 6965124-6965187,6965263-6965493,6965580-6965714, 6966484-6966517,6966664-6966692 Length = 412 Score = 28.3 bits (60), Expect = 4.0 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSI 336 +PY G + + FP ++P KPP + Sbjct: 189 TPYHDGLFFFDVYFPSQYPKKPPLV 213 >01_01_0939 - 7404209-7404490,7405057-7405368,7405470-7405609, 7406226-7406289,7406378-7406616,7406957-7406983, 7407590-7407749 Length = 407 Score = 28.3 bits (60), Expect = 4.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSIY 339 +PY G + + FP E+P PP ++ Sbjct: 188 TPYHDGLFFFDVRFPSEYPQSPPKVH 213 >01_01_0167 + 1422344-1424260,1424338-1424472,1424568-1424990, 1425183-1425252,1425356-1425495,1425620-1425679, 1425776-1425931,1426272-1426541 Length = 1056 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 253 AEKSPYEGGYYHGKIIFPREFPFKPPSIY 339 A +PY+ G + P EFP PPS Y Sbjct: 870 ASGTPYQDGLFFFDFHLPPEFPQVPPSAY 898 >10_08_0755 - 20329127-20329189,20329276-20329389,20329465-20329617, 20331790-20332035 Length = 191 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 268 YEGGYYHGKIIFPREFPFKPP 330 +EGGYY + F ++P KPP Sbjct: 85 WEGGYYPLTLHFSEDYPSKPP 105 >09_02_0309 - 7151297-7151437,7151532-7151657,7152068-7152217 Length = 138 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSIYMITPNGSSRQTHDCASV 390 S +EG Y K+ +++P KPPS+ + S H+ +V Sbjct: 51 SVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMSCVNHETGAV 93 >01_01_0928 + 7339796-7339806,7339923-7340043,7340463-7340549, 7341230-7341637,7341726-7341789,7342654-7342793, 7342878-7343189,7343733-7344137 Length = 515 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 262 SPYEGGYYHGKIIFPREFPFKPPSIY 339 +PY G + I F +P PPS+Y Sbjct: 255 TPYHDGLFFFDIQFSNSYPANPPSVY 280 >10_08_0197 + 15666873-15666916,15667098-15667177,15667490-15667604, 15667698-15667786,15667850-15667978,15670362-15670492 Length = 195 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 259 KSPYEGGYYHGKIIFPREFPFKPPSI 336 +S Y+GG + ++ P +P+K PSI Sbjct: 41 ESIYQGGVWKVRVELPDAYPYKSPSI 66 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,923,868 Number of Sequences: 37544 Number of extensions: 319370 Number of successful extensions: 860 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1166441080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -