BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0826 (528 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 1.6 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 4.8 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 6.3 AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismuta... 23 8.4 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 8.4 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +3 Query: 246 LKGGEKSLRRGILSWKDYFPKGISVQTTFDLHDNTEW 356 L+GG S+ I + P S + F LH+N E+ Sbjct: 599 LQGGNSSISLPIFAQNQRMPSEESHEFAFRLHENPEY 635 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 4 HENRLVLRNENILYVVICYKTFYS 75 HE++L+L NE+ + V+ +TF S Sbjct: 774 HEDKLLLTNEDFVPVIEIDETFTS 797 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 6.3 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = -3 Query: 229 QYVGRHRFGRNIWYWVILEP 170 +Y+ +HR +W++V +P Sbjct: 1157 RYIPKHRIQYKVWWFVTSQP 1176 >AY505417-1|AAR90328.1| 206|Anopheles gambiae superoxide dismutase 1 protein. Length = 206 Score = 22.6 bits (46), Expect = 8.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -3 Query: 361 NCHSVLSCKSKVV*TEIP 308 NC +VL C+SK ++P Sbjct: 23 NCSAVLGCRSKHTLPDLP 40 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 22.6 bits (46), Expect = 8.4 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -3 Query: 286 DNIPLRRDFSPPFNDVMPFQYVGRHRFGRNIWYWVILEPQIILLQS 149 D+IP +FS D PFQ++ + R W+ P+ +LL + Sbjct: 483 DHIPAPDEFSLLAQDGTPFQHLHQLRELDLSSNWLTAVPRDLLLNT 528 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,215 Number of Sequences: 2352 Number of extensions: 12738 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -