BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0825 (705 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 1.8 EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 22 4.2 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 21 7.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.8 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 646 LILGLGHFGRSF 681 L+LGLG +GRSF Sbjct: 260 LVLGLGVYGRSF 271 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = +2 Query: 491 EEVPVLDRHARIETSDTFLD--SIHQN 565 E + L+++ + T+DTFLD S +QN Sbjct: 391 EIITYLEKNGKPRTTDTFLDLWSDYQN 417 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 21.4 bits (43), Expect = 7.4 Identities = 12/57 (21%), Positives = 24/57 (42%) Frame = +1 Query: 70 GSADFKVRVFSAYIKDIEDQPGPNVWGSKLPLGQLLAEFPNSPSGGGWVHSVSFSAD 240 G DF +V +IK ++ + ++ K L +L E + VH + + + Sbjct: 56 GGEDFDQKVMDYFIKMVKQKHKKDIRADKKALQKLRREVEKAKRDLSSVHKTTLTIE 112 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 9.8 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +1 Query: 637 RAALILGLGHFGRSF 681 ++ ++LG+ FGRSF Sbjct: 410 KSKIVLGVPFFGRSF 424 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,202 Number of Sequences: 336 Number of extensions: 3589 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -