BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0825 (705 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 2.8 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 3.7 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.0 bits (47), Expect = 2.8 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = -3 Query: 325 VFSFMTALPLVASVTLIELSWATQQLYFRPQRRKRCGPNRHL 200 V F+T + +SW ++L R RRK G HL Sbjct: 235 VSGFITTEVAGTYAIFLYISWHQKELVRRDSRRKNYGGVYHL 276 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/44 (20%), Positives = 21/44 (47%) Frame = +3 Query: 465 NESGGLSAMKKFQSLIVMLVSRPAIHSWTRYTRTLSRASIFSKG 596 N G ++ ++K + + L+ + + SW YT+ + + G Sbjct: 127 NTDGDIAGLRKKKHKVNPLLMQSGMGSWEVYTKGIGAKLLLQMG 170 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,411 Number of Sequences: 438 Number of extensions: 4636 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -