BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0824 (696 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 27 0.11 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 5.5 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 7.3 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 9.6 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 21 9.6 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 27.5 bits (58), Expect = 0.11 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 189 F*IFRVYYYVCTDFQCIFFVVTVCVY 266 F IF V++ +CT + F++ +CVY Sbjct: 89 FIIFTVHFLLCTYYFYYAFIILLCVY 114 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +2 Query: 464 ERERESENTLYWQTNQFTLKKKIACVQ 544 + E E +T+YW T +F L K+ V+ Sbjct: 390 DAEIEKLSTVYWFTVEFGLCKESGVVK 416 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/39 (25%), Positives = 18/39 (46%) Frame = +2 Query: 461 EERERESENTLYWQTNQFTLKKKIACVQFTRVRSETFKK 577 ++R R +Y + +FT + + V SET +K Sbjct: 321 QDRLRHEVTEIYNENGEFTYENILGMKYLDMVISETLRK 359 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -2 Query: 278 NNIIIHTHRNYEKNALKISTNIII 207 NN+++H +N L I +++I Sbjct: 107 NNVLVHRSQNSNDVCLAIPESLVI 130 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +3 Query: 306 FVCKYLFCSR 335 FVC +LFC + Sbjct: 345 FVCNWLFCGK 354 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,429 Number of Sequences: 336 Number of extensions: 4408 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -