BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0824 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1519 + 27390204-27390590,27390591-27390809,27392516-273929... 31 0.66 >07_03_1519 + 27390204-27390590,27390591-27390809,27392516-27392962, 27393076-27393274,27393372-27393456,27393566-27393998 Length = 589 Score = 31.5 bits (68), Expect = 0.66 Identities = 24/64 (37%), Positives = 32/64 (50%), Gaps = 5/64 (7%) Frame = +2 Query: 425 KNIITKKKPHLFEERERESENTLYWQTNQFTL---KKKIACVQFTRVRSETFKKLK--YN 589 KNII L EE +E E L + + + KKK+AC F + RS FKK++ N Sbjct: 15 KNIIAVGLDDLTEEDRQELERELKHELEEEKMERTKKKLAC--FQKTRSGAFKKVRSEVN 72 Query: 590 YPKC 601 P C Sbjct: 73 KPIC 76 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,001,183 Number of Sequences: 37544 Number of extensions: 319945 Number of successful extensions: 511 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 494 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -