BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0823 (606 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016657-11|AAB93655.1| 282|Caenorhabditis elegans Hypothetical... 30 1.5 AF025471-1|AAB71058.1| 379|Caenorhabditis elegans Hypothetical ... 29 2.6 >AF016657-11|AAB93655.1| 282|Caenorhabditis elegans Hypothetical protein C16C4.10 protein. Length = 282 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/30 (53%), Positives = 18/30 (60%) Frame = +3 Query: 30 NTEFRFNPIPWEV*IVTFNIFKWLAIACYK 119 NTE RFN IPW + I FN F L + C K Sbjct: 164 NTEKRFN-IPWRLQIQRFNEFFGLYLRCEK 192 >AF025471-1|AAB71058.1| 379|Caenorhabditis elegans Hypothetical protein R52.3 protein. Length = 379 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 30 NTEFRFNPIPWEV*IVTFNIFKWLAIACYK 119 +T++RFN IPW + I+ N F L I C K Sbjct: 244 DTQYRFN-IPWSLKILNRNEFSGLFIRCEK 272 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,421,632 Number of Sequences: 27780 Number of extensions: 244290 Number of successful extensions: 370 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 370 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1300523034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -