BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0823 (606 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 27 0.14 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 27 0.14 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 5.4 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 27.1 bits (57), Expect = 0.14 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 121 HHTNLGYICIIFKLHSIITLVC*KKSKIF 207 H T + +C+ L + +TLVC KI+ Sbjct: 733 HETQITTLCVAISLSATVTLVCLYSPKIY 761 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 27.1 bits (57), Expect = 0.14 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +1 Query: 121 HHTNLGYICIIFKLHSIITLVC*KKSKIF 207 H T + +C+ L + +TLVC KI+ Sbjct: 823 HETQITTLCVAISLSATVTLVCLYSPKIY 851 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.8 bits (44), Expect = 5.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -1 Query: 390 LTKLQSVLEFTIYKNKIYVQAPQALRDCIVI 298 L K+ VLE T Y N Y+ A D I Sbjct: 229 LIKISDVLEETFYNNGDYIIRQGARGDTFFI 259 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,265 Number of Sequences: 438 Number of extensions: 3531 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -