BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0820 (600 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 1.3 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 5.3 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 7.0 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 1.3 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 9/49 (18%) Frame = +2 Query: 479 TAEPVNAPAKRNLQKILAKPEIL---------NPIYPEPTNLFQLTSLN 598 T P A + L K++ P+ L NP+ P+ +L QLTS++ Sbjct: 880 THRPTFANLTQTLDKLIRSPDTLRKIAQNRGTNPLAPDAVDLTQLTSVS 928 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 1 RRHSFSSCVD*LXVNKY*RKNNNIKTRKSLCV 96 RRHS S C+ +N R N + R++ C+ Sbjct: 349 RRHSDSCCLCLDSMNAVIRNFNESENRRNSCL 380 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +2 Query: 482 AEPVNAPAKRNLQKILAKPEI 544 +EPV P ++N + KPE+ Sbjct: 335 SEPVEPPRRKNNCPLHCKPEL 355 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,817 Number of Sequences: 438 Number of extensions: 1599 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -