BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0816 (540 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC144.15c |cog1||Golgi transport complex subunit Cog1 |Schizos... 25 5.4 SPCC63.05 |||TAP42 family protein |Schizosaccharomyces pombe|chr... 25 7.2 >SPAC144.15c |cog1||Golgi transport complex subunit Cog1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 701 Score = 25.4 bits (53), Expect = 5.4 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +3 Query: 282 YIIYLKRIFASTLLFVLI*TEVQQFLSNA 368 Y I+L+R +A +LFV+ +Q+L ++ Sbjct: 108 YFIFLQRFYAHAILFVMELFNKEQYLQSS 136 >SPCC63.05 |||TAP42 family protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 323 Score = 25.0 bits (52), Expect = 7.2 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -3 Query: 532 NFRDITLDKKRRPLSFC*TQIGDKN*MGLDVFG 434 N RD LDK RPL T + D+N +VFG Sbjct: 219 NTRDKILDKNNRPLQPF-TIVSDRNETRKNVFG 250 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,145,416 Number of Sequences: 5004 Number of extensions: 42667 Number of successful extensions: 76 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -