SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0815
         (666 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855491-1|ABH88178.1|  144|Tribolium castaneum chemosensory pro...    21   6.9  
DQ855489-1|ABH88176.1|  122|Tribolium castaneum chemosensory pro...    21   6.9  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   6.9  
AJ973444-1|CAJ01491.1|  122|Tribolium castaneum hypothetical pro...    21   6.9  
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    21   9.1  

>DQ855491-1|ABH88178.1|  144|Tribolium castaneum chemosensory
           protein 5 protein.
          Length = 144

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 7/15 (46%), Positives = 10/15 (66%)
 Frame = -3

Query: 604 VTGCTKCSDINYPSA 560
           VT C+KCS++    A
Sbjct: 82  VTNCSKCSEVQKKQA 96


>DQ855489-1|ABH88176.1|  122|Tribolium castaneum chemosensory
           protein 2 protein.
          Length = 122

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 604 VTGCTKCSD 578
           +TGC KC+D
Sbjct: 69  ITGCRKCND 77


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 10/31 (32%), Positives = 14/31 (45%)
 Frame = -2

Query: 545  PIEYAIVFSNFRPPCHKIRFAFEILNGSGFG 453
            PI+Y +VFS F      +    +I     FG
Sbjct: 1080 PIDYTLVFSKFTSSIRMLLIQGQIFGLITFG 1110


>AJ973444-1|CAJ01491.1|  122|Tribolium castaneum hypothetical
           protein protein.
          Length = 122

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 604 VTGCTKCSD 578
           +TGC KC+D
Sbjct: 69  ITGCRKCND 77


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 21.0 bits (42), Expect = 9.1
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 199 TWPRRPLMRLP 231
           TWP RP+ ++P
Sbjct: 281 TWPARPVNQVP 291


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,716
Number of Sequences: 336
Number of extensions: 2829
Number of successful extensions: 13
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17281430
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -