BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0814 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0505 - 4379722-4380795,4380868-4381008,4381099-4381270,438... 28 8.1 04_04_0294 + 24204563-24204748,24205531-24205620,24205980-242062... 28 8.1 >08_01_0505 - 4379722-4380795,4380868-4381008,4381099-4381270, 4381944-4382047,4382127-4382259,4384477-4384653, 4385164-4385309,4385536-4385625,4385703-4385915, 4386090-4386182,4386743-4386937,4387018-4387110, 4387924-4388019,4388556-4388985,4389424-4390091, 4392074-4392271,4392690-4393407,4394036-4394181 Length = 1628 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 387 SNQPKVPKFKNFSNASSGSHTYSNDLVNSDNSVKLELSQLACLKIISH 530 S+QP +F N ++ SH +SN + S + E S + ++ SH Sbjct: 1355 SSQPTSHEFLNMPSSQPSSHEFSN--IKSSQTTSHEFSNVQTSQLASH 1400 >04_04_0294 + 24204563-24204748,24205531-24205620,24205980-24206211, 24207180-24207457,24207576-24207647,24208054-24208295, 24208781-24209197,24209296-24209497,24209624-24209738, 24209821-24209906,24210235-24210354,24210431-24210519, 24210588-24210669,24211072-24211263,24211546-24211668 Length = 841 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +2 Query: 515 KNNIPYKFWDSVEPYCAPVTLDDIKF 592 ++N KFW PYC ++ IKF Sbjct: 66 RSNAVKKFWQQFHPYCNSSAVERIKF 91 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,659,322 Number of Sequences: 37544 Number of extensions: 290929 Number of successful extensions: 680 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -