BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0813 (485 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q10L90 Cluster: Putative uncharacterized protein; n=2; ... 33 2.6 UniRef50_UPI0000F2C20F Cluster: PREDICTED: hypothetical protein;... 33 4.5 UniRef50_A0VFC9 Cluster: Putative uncharacterized protein; n=1; ... 32 6.0 UniRef50_A6NZC3 Cluster: Putative uncharacterized protein; n=1; ... 32 7.9 UniRef50_Q69LT5 Cluster: Putative uncharacterized protein OSJNBb... 32 7.9 >UniRef50_Q10L90 Cluster: Putative uncharacterized protein; n=2; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 555 Score = 33.5 bits (73), Expect = 2.6 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +1 Query: 37 KVGTFFLPILFGSELSPALREEQPFRLWVLKHGQLMTSSEVSAGWSHSASSLI 195 K+ ++LP FG+ A F LW+L+H LM SS++ W H A L+ Sbjct: 271 KMTKYWLPYTFGALGLSA------FTLWLLRHSSLMGSSDID-NWLHGAKKLL 316 >UniRef50_UPI0000F2C20F Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 179 Score = 32.7 bits (71), Expect = 4.5 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +2 Query: 95 GKSSPSAFGC*STVNS*PALKFRLVGRI--QHPASSALPRMVPTLCHTGRGPLSLPPPVF 268 G SSP + ST+ P + RL+ + Q P SS L P+L H + P S PPP Sbjct: 27 GASSPISVPAPSTIGPSPPRRRRLLPQEPQQSPHSSPLFSSSPSLQHLPKQPPSAPPPRS 86 Query: 269 IYTLGVGQTRPCG 307 V RP G Sbjct: 87 QSRRSVPPQRPRG 99 >UniRef50_A0VFC9 Cluster: Putative uncharacterized protein; n=1; Delftia acidovorans SPH-1|Rep: Putative uncharacterized protein - Delftia acidovorans SPH-1 Length = 258 Score = 32.3 bits (70), Expect = 6.0 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +2 Query: 161 RLVGRIQHPASSALPRMVPTLCHTG 235 RLVGR HP ++AL R LCH G Sbjct: 154 RLVGRRDHPRAAALAREQQALCHQG 178 >UniRef50_A6NZC3 Cluster: Putative uncharacterized protein; n=1; Bacteroides capillosus ATCC 29799|Rep: Putative uncharacterized protein - Bacteroides capillosus ATCC 29799 Length = 241 Score = 31.9 bits (69), Expect = 7.9 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +2 Query: 203 PRMVPTLCHTGRGPLSLP 256 P VP LCHTG PLSLP Sbjct: 118 PYDVPILCHTGTAPLSLP 135 >UniRef50_Q69LT5 Cluster: Putative uncharacterized protein OSJNBb0014G01.39; n=1; Oryza sativa (japonica cultivar-group)|Rep: Putative uncharacterized protein OSJNBb0014G01.39 - Oryza sativa subsp. japonica (Rice) Length = 82 Score = 31.9 bits (69), Expect = 7.9 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +2 Query: 191 SSALPRMVPTLCHTGRGPLSLPPP 262 ++A+PR+ P LC+ GP + PPP Sbjct: 25 AAAVPRVSPPLCNAATGPRATPPP 48 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 541,422,069 Number of Sequences: 1657284 Number of extensions: 11280667 Number of successful extensions: 28689 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28682 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 28130105105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -