BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0813 (485 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 2.4 AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F pro... 24 3.2 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 4.2 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 4.2 AJ697719-1|CAG26912.1| 174|Anopheles gambiae putative odorant-b... 23 7.3 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 24.2 bits (50), Expect = 2.4 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = -2 Query: 388 HYKKLSCLILTT*LSKNYPKLNQSI 314 H+++L+ ++ L +NYP+L +S+ Sbjct: 771 HFQRLAFIVALDRLVENYPRLARSV 795 >AY579077-1|AAT81601.1| 101|Anopheles gambiae neuropeptide F protein. Length = 101 Score = 23.8 bits (49), Expect = 3.2 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 86 RRCGKSSPSAFGC*STVNS*PALKFRLVGRIQHPASSALP 205 +R G +P+ FG N +RL+GRIQH LP Sbjct: 64 KRGGYLNPAIFGQDEQENL-----YRLIGRIQHFRDEQLP 98 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 23.4 bits (48), Expect = 4.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 399 SHLLIDLMHLIIPSQASKW 455 SH IDL LI ++A+KW Sbjct: 53 SHYKIDLRSLIKEARANKW 71 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.4 bits (48), Expect = 4.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 125 STQRRKGCSSRSAGDNSEPNKMGRK 51 S+ G SRS D E + +GRK Sbjct: 639 SSTTHSGAPSRSQSDEDEQHSVGRK 663 >AJ697719-1|CAG26912.1| 174|Anopheles gambiae putative odorant-binding protein OBPjj9 protein. Length = 174 Score = 22.6 bits (46), Expect = 7.3 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -1 Query: 263 PEAGVRAALAQCDRVWVPYEVEQMRLDAECDQPAETSEL 147 PE ++ A+AQC+R ++ L+ P ET ++ Sbjct: 62 PEVTMQDAIAQCNRSFIIQPEYLAELNQTGSFPEETDKI 100 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 558,770 Number of Sequences: 2352 Number of extensions: 10556 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42708759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -