BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0808 (681 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0759 + 27008772-27009571,27010457-27010576,27011683-270119... 29 3.4 10_08_0743 + 20249478-20250021,20250673-20250740,20250923-20250964 29 4.5 07_03_0200 - 15016084-15016342,15016814-15016869,15016963-150179... 28 6.0 >11_06_0759 + 27008772-27009571,27010457-27010576,27011683-27011957, 27012516-27013783 Length = 820 Score = 29.1 bits (62), Expect = 3.4 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 300 IPCKNKTLKMFSLLEYT*PFQPIKLNSQLSF*KWIGFTFD 419 I CK +L+ L + P + +++ + SF K GFTFD Sbjct: 669 ILCKMSSLQRLVLTQVHMPIKQLEITKEASFSKLNGFTFD 708 >10_08_0743 + 20249478-20250021,20250673-20250740,20250923-20250964 Length = 217 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +1 Query: 55 RVPLPQNILCI-LSFFLMQNPALTDFGLFGLSAFCT 159 ++P + +C +F + P L DFG F L+ FC+ Sbjct: 53 QIPPSEGRICFCFAFAFLPPPDLADFGWFSLALFCS 88 >07_03_0200 - 15016084-15016342,15016814-15016869,15016963-15017960, 15018707-15018768,15019242-15019274,15019697-15019881, 15020033-15020133,15020783-15020795,15021216-15021319, 15021593-15021693,15022773-15022849,15022965-15023021, 15023158-15023268,15023803-15023859 Length = 737 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -3 Query: 424 SRSNVKPIHFQKES*LFNFIG*KGHVYSNNENILSVLFLHGIK 296 S N P+H + IG H+ + EN+ L+L GI+ Sbjct: 318 SEDNDLPLHHSSRNSAVPLIGFSPHIIDDRENVGKFLYLEGIE 360 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,581,077 Number of Sequences: 37544 Number of extensions: 305306 Number of successful extensions: 561 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 561 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -