BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0808 (681 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 0.67 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 0.67 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 25.0 bits (52), Expect = 0.67 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 3/79 (3%) Frame = +3 Query: 273 PVFVFGALFIPCKNKTLKMFSLLEYT*PFQPIKLNSQLSF*KWIGFTFDRDLSQTYKH-- 446 P+F++ P + L+ L+ T PF P+ S L G D +L+++ +H Sbjct: 151 PIFLYALGEQPLTEQNLEELRDLKETYPFNPVLFISSLENISLNG--IDPELTESEQHRL 208 Query: 447 -NRPLTTSSISRDWDYSAV 500 NR T S S D ++ Sbjct: 209 QNRLYTNDSTSSKTDDDSI 227 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 25.0 bits (52), Expect = 0.67 Identities = 21/79 (26%), Positives = 35/79 (44%), Gaps = 3/79 (3%) Frame = +3 Query: 273 PVFVFGALFIPCKNKTLKMFSLLEYT*PFQPIKLNSQLSF*KWIGFTFDRDLSQTYKH-- 446 P+F++ P + L+ L+ T PF P+ S L G D +L+++ +H Sbjct: 189 PIFLYALGEQPLTEQNLEELRDLKETYPFNPVLFISSLENISLNG--IDPELTESEQHRL 246 Query: 447 -NRPLTTSSISRDWDYSAV 500 NR T S S D ++ Sbjct: 247 QNRLYTNDSTSSKTDDDSI 265 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,647 Number of Sequences: 438 Number of extensions: 3485 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -