BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0805 (600 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 28 0.27 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 2.5 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 5.7 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 10.0 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 10.0 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 23 10.0 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 10.0 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 27.9 bits (59), Expect = 0.27 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +3 Query: 390 LFSSTHVPHHIKADAQVRQQLNMSHST 470 LFSS H+P+H+ AD Q L+ ST Sbjct: 333 LFSSKHLPYHLDADEQQIPTLSEMVST 359 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 24.6 bits (51), Expect = 2.5 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 82 GRYTYVHCEGLPTC 123 GRYT +CE PTC Sbjct: 664 GRYTGRYCEKCPTC 677 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.4 bits (48), Expect = 5.7 Identities = 16/49 (32%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = +3 Query: 108 RPTYLSMSRSVLL-PICVPTPADRPSRSAYSTIGRSSLETRANLRASPT 251 RP L+ S L P +P A RP + + RS+ + RAN + T Sbjct: 586 RPNALASPASPLKSPSKIPGLARRPENISSESRSRSTSKQRANAKTPET 634 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 22.6 bits (46), Expect = 10.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -2 Query: 266 VSCTRCRACSEVRTGLQGGPANGRIRTAGRPVRRCWNANRQ*N 138 +S T A + + T L G P +G +T +P + C N++ N Sbjct: 1670 MSATSMAASAAMHTVLSG-PNDGSSQTEMKPKQNCVNSSNTYN 1711 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 22.6 bits (46), Expect = 10.0 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = +2 Query: 155 RSNTGGQAFPQCVFDHWQVLPGDPCE 232 + N G+ +C +W ++ G+ CE Sbjct: 912 KPNVIGRTCNECKNGYWNIVSGNGCE 937 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 22.6 bits (46), Expect = 10.0 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 74 TLRKRDHDVCSVHRRYHP 21 T+ + H+ CS H R HP Sbjct: 385 TVGQWKHEGCSSHERLHP 402 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 22.6 bits (46), Expect = 10.0 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = +3 Query: 132 RSVLLPICVPTPADRPSRSAYSTIGRSSLETRANL 236 +++ + +C+PTP +R + + Y + R + T NL Sbjct: 227 KALTVRLCLPTPPNRLTNNGYWQL-RPHVLTERNL 260 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 627,737 Number of Sequences: 2352 Number of extensions: 14298 Number of successful extensions: 24 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58029966 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -