BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0804 (631 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC364.02c |bis1||stress response protein Bis1|Schizosaccharomy... 27 2.2 SPCC550.15c |||ribosome biogenesis protein |Schizosaccharomyces ... 27 2.2 SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT |Schizosa... 26 3.9 SPCC126.09 |||vacuolar membrane zinc transporter |Schizosaccharo... 25 9.0 SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|ch... 25 9.0 >SPCC364.02c |bis1||stress response protein Bis1|Schizosaccharomyces pombe|chr 3|||Manual Length = 384 Score = 27.1 bits (57), Expect = 2.2 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -1 Query: 232 LLNLTKQARRVHTENYLRD*PWTTTRPVIKAHTAHR 125 L NLT ARR+ +YLR P + P HTA R Sbjct: 326 LTNLTPAARRLVARSYLRS-PLHGSSPSASRHTALR 360 >SPCC550.15c |||ribosome biogenesis protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 463 Score = 27.1 bits (57), Expect = 2.2 Identities = 25/68 (36%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Frame = +3 Query: 198 CTLRACLVRFNKLSTQNQHYESDGNGLLLERGKVGASLEVPLRG*VFDPK-ASLNLWRVE 374 CT C V FN +Q H++SD + L+R KV ASL PL VF K S+ E Sbjct: 7 CT--TCTVAFNNAESQKIHWKSDWHHYNLKR-KV-ASLP-PLSAEVFAGKILSIQKQNEE 61 Query: 375 LRRNISIY 398 +++ Y Sbjct: 62 VQKKAEFY 69 >SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT |Schizosaccharomyces pombe|chr 2|||Manual Length = 509 Score = 26.2 bits (55), Expect = 3.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 137 VGFYYRPGRCPWLIT*IILG 196 V +YR R PW+I +ILG Sbjct: 84 VAAFYRSSRMPWIIFIVILG 103 >SPCC126.09 |||vacuolar membrane zinc transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 418 Score = 25.0 bits (52), Expect = 9.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 379 GGIFQYIIKHFFLRWVDE 432 GGI YI HF +W+ E Sbjct: 126 GGIVFYIFNHFLHKWLHE 143 >SPAC6G9.06c |pcp1||pericentrin Pcp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1208 Score = 25.0 bits (52), Expect = 9.0 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 393 LKYSSLILPSINLMTLLDRR 334 LKYSSL IN LLDRR Sbjct: 712 LKYSSLKNELINAQNLLDRR 731 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,618,165 Number of Sequences: 5004 Number of extensions: 53251 Number of successful extensions: 79 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -