BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0804 (631 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 3.5 AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylch... 24 3.5 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.2 bits (50), Expect = 3.5 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +2 Query: 263 GWKWITIRTR*GRSEFGGTSARLGLRSKSVIKFMEGRIKEEYF 391 GWKW+++R R + G +G ++ R E Y+ Sbjct: 738 GWKWMSVRPRSPQPHHGHGGIPVGHYAQHHFNSQGSRKAEPYY 780 >AY705404-1|AAU12513.1| 406|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 9 protein. Length = 406 Score = 24.2 bits (50), Expect = 3.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 207 RACLVRFNKLSTQNQHYESDGNGLLLERGKV 299 R +V +N +QH+ D N L+ GKV Sbjct: 120 RPDVVLYNNAGGSDQHHYGDTNVLVYSEGKV 150 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 666,306 Number of Sequences: 2352 Number of extensions: 13264 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61468785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -