BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0802 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) 116 2e-26 SB_47597| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_34699| Best HMM Match : Peptidase_S8 (HMM E-Value=1.5e-07) 30 2.1 SB_6573| Best HMM Match : FtsX (HMM E-Value=0.27) 30 2.1 SB_43038| Best HMM Match : AAA (HMM E-Value=0.84) 29 4.8 SB_38184| Best HMM Match : HisKA_2 (HMM E-Value=8.6) 29 4.8 SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_44267| Best HMM Match : DUF602 (HMM E-Value=1.1e-29) 28 8.4 SB_34887| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.95) 28 8.4 SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) 28 8.4 SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_50641| Best HMM Match : Rad21_Rec8_N (HMM E-Value=0) 28 8.4 SB_39708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) Length = 245 Score = 116 bits (279), Expect = 2e-26 Identities = 51/74 (68%), Positives = 64/74 (86%) Frame = +3 Query: 306 EVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVYKRGFAKLS 485 +VRK+LQL RLRQINNGVFVRLNKAT NMLRI +PYIA+GYPNLKSVREL+YKRG+ K+ Sbjct: 101 KVRKILQLLRLRQINNGVFVRLNKATANMLRIVQPYIAFGYPNLKSVRELIYKRGYGKVD 160 Query: 486 GQRIPITSTALLRR 527 QR+ +T +++ + Sbjct: 161 KQRVALTDNSIVEK 174 Score = 111 bits (268), Expect = 4e-25 Identities = 50/63 (79%), Positives = 55/63 (87%) Frame = +2 Query: 509 NSIVEKRLHKHNIICVEDLIHEIFTVGEKFKYASNFLWPFKLNNPTGGWRKKTIHYVDGG 688 NSIVEK L KH IICVEDLIHEIFTVGE FK ASNFLWPFKL++P GG+RKKT H+V+GG Sbjct: 169 NSIVEKVLGKHGIICVEDLIHEIFTVGEHFKEASNFLWPFKLSSPKGGFRKKTTHFVEGG 228 Query: 689 DFG 697 D G Sbjct: 229 DHG 231 Score = 73.7 bits (173), Expect = 1e-13 Identities = 35/81 (43%), Positives = 50/81 (61%) Frame = +2 Query: 14 EDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKE 193 +D K+P VPE++LK + L ++ K++EIFKRAE+YVKEYR KE Sbjct: 3 QDRVKVPRVPETLLKKRKSLEQIKAARAKAQLAQKKLQHGKRKEIFKRAEKYVKEYRQKE 62 Query: 194 RDEIRLARQARNRGNYYVPGE 256 DE+R+ + A+ GN+YVP E Sbjct: 63 VDELRMKKMAKKHGNFYVPPE 83 Score = 35.5 bits (78), Expect = 0.042 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = +1 Query: 256 AKLAFVIRIRGINQVSPKSVKFCNCL 333 A+LAFVIRIRGIN VSPK K L Sbjct: 84 ARLAFVIRIRGINGVSPKVRKILQLL 109 >SB_47597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = -2 Query: 571 MDEVLNTDNVVFMEPLLNNAVEVIGIRCPLSLANPRLYTNSRTL 440 +D LN +VF E +LN+AV ++ LSL P+ Y NS +L Sbjct: 124 VDPTLNM--LVFGESILNDAVSIVMTNTILSLGGPK-YANSSSL 164 >SB_34699| Best HMM Match : Peptidase_S8 (HMM E-Value=1.5e-07) Length = 785 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -2 Query: 592 FSNSEDLMDEVLNTDNVVFMEPLLNNAVEVIGIRCP 485 FS DLM+E++N V+F+ NN + + CP Sbjct: 314 FSRVVDLMNELVNEHGVIFISSAGNNGPALSTVGCP 349 >SB_6573| Best HMM Match : FtsX (HMM E-Value=0.27) Length = 275 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = -2 Query: 571 MDEVLNTDNVVFMEPLLNNAVEVIGIRCPLSLANPRLYTNSRTL 440 +D LN +VF E +LN+AV ++ LSL P+ Y NS +L Sbjct: 25 VDPTLNM--LVFGESILNDAVSIVMTNTILSLGGPK-YANSSSL 65 >SB_43038| Best HMM Match : AAA (HMM E-Value=0.84) Length = 957 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +3 Query: 288 YQPSFTEVRKVLQLFRLRQINNGVFVRLNKATVNMLRIAEPYIAWGYPNLKSVRELVY 461 YQ T + + L + IN G +N++ VN+ R A + YP++KSVR +Y Sbjct: 231 YQNGTTFFYEQVNLHKTVVINKGTDSIINES-VNLPRRARDSEKFVYPDIKSVRVTIY 287 >SB_38184| Best HMM Match : HisKA_2 (HMM E-Value=8.6) Length = 528 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 545 IICVEDLIHEIFTVGEKFKYASNFLWPFKLNNPTGGWRKKT 667 + C+ + E+ TV E F+ NFL FK+ P KKT Sbjct: 344 LTCLCGDLSEMITVEEAFQMCENFLEKFKIFFPLDAPNKKT 384 >SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 116 RSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 241 R AI ++RE+++R E Y + + R+ R R R Y Sbjct: 16 RRRAINRRREMYRRREMYRRREMYRRREMYRRREMYRRREMY 57 >SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.3 bits (60), Expect = 6.3 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 116 RSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 241 R + ++REI++R E Y + + R+ RL R R Y Sbjct: 27 RRREMYRRREIYRRREMYRRREMYRRREMYRLREMYRRREMY 68 >SB_44267| Best HMM Match : DUF602 (HMM E-Value=1.1e-29) Length = 482 Score = 27.9 bits (59), Expect = 8.4 Identities = 21/77 (27%), Positives = 32/77 (41%), Gaps = 2/77 (2%) Frame = +2 Query: 8 RKEDSKKLP--AVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEY 181 +KE SK + AV +S+LK + T ++ AI KKR + +Y++ Sbjct: 307 KKESSKHIEKNAVKKSILKAPKRNAKKAATDAEQTTTKK--AIDKKRRRYNSRRRYIRRR 364 Query: 182 RIKERDEIRLARQARNR 232 R R R R R Sbjct: 365 RFTSRRRATRRRYTRRR 381 >SB_34887| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.95) Length = 439 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +2 Query: 122 SAIKKKREIFKRAEQYVKEY--RIKERDEIRLARQARNRGNYYVPGEPNW 265 + + +++ +++ K+Y ++ + D ++LAR RNRG P E W Sbjct: 106 NTVSLPKQLDANLKEFFKKYPRKVLQNDGLKLARHLRNRGR---PTETTW 152 >SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) Length = 712 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 188 KERDEIRLARQARNRGNYYVP 250 K RD +AR+ R+RG YY+P Sbjct: 483 KIRDTSSIARETRSRGPYYLP 503 >SB_4649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 630 LKGHRKLLAYLNFSPTVKISWMRSSTQIMLCLWSLFS 520 LKGH K L+++P V + + +S +CLW + S Sbjct: 239 LKGHTKEGYGLSWNPNVNGNLLSASDDHTICLWDISS 275 >SB_50641| Best HMM Match : Rad21_Rec8_N (HMM E-Value=0) Length = 816 Score = 27.9 bits (59), Expect = 8.4 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 485 WTTYTNHFNSIVEKRLHKHNIICVEDLIHEIFTVGEKFKYASNFL 619 WT T+ S ++K +K N +C+ L+ + +K+ S L Sbjct: 742 WTKRTHQLLSALKKEFNKKNTVCLNSLVQKNTRKQAAYKFYSCLL 786 >SB_39708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 27.9 bits (59), Expect = 8.4 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 566 IHEIFTVGEKFKYASNFLWPFKLNN 640 ++ + T KF YA++ LW F NN Sbjct: 58 LNRVITTTGKFSYATDDLWQFSCNN 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,926,562 Number of Sequences: 59808 Number of extensions: 489010 Number of successful extensions: 1238 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1237 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -