BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0801 (686 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 52 3e-09 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 22 4.1 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 7.2 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 7.2 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 52.4 bits (120), Expect = 3e-09 Identities = 25/55 (45%), Positives = 33/55 (60%) Frame = +3 Query: 255 LCTDVAARGLDIPAVDWIVQYDPPDDPKEYIHRVGRTARGLGTSGHALLFLRPEE 419 + T VAARGLDI V ++ YD P EY+HR+GRT R +G G A F ++ Sbjct: 464 VATGVAARGLDIKDVQHVINYDLPKSIDEYVHRIGRTGR-VGNKGKATSFFDEDQ 517 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = -1 Query: 143 WWYLTDIQVEKNTITFFFLFFLRNVNKTIIRFSDGH 36 +++L + + +T FF F + + + I+RF H Sbjct: 55 YYWLNVCCLNLSIVTIFFNFATKKLEQFIVRFMKYH 90 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 7.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 472 SNSFRVTLDCFKYRKNPSSSGRKNNKACPLV 380 S S V+++ + +PSSS N +CP V Sbjct: 146 SMSVNVSMNMTMHGYHPSSSYPANEISCPQV 176 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.4 bits (43), Expect = 7.2 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 199 VVVFHVWTSQE 167 V+ HVWTS+E Sbjct: 288 VIPIHVWTSKE 298 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,997 Number of Sequences: 336 Number of extensions: 3889 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -