BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0800 (696 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 5.3 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 23 7.0 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 9.2 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 5.3 Identities = 10/32 (31%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 536 VLNNMVCVDFQWIRSESVSEH-HAFPVRVELV 444 + NN + + F+W+ S S+ E+ + F RV ++ Sbjct: 3099 MFNNWIKLPFEWLFSTSMRENENEFDKRVSMI 3130 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.4 bits (48), Expect = 7.0 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 49 YDSDEDTTDGTWEHKL 96 YD+DED +G +H+L Sbjct: 419 YDTDEDVINGVPDHQL 434 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +3 Query: 312 LGWNEGQGLGVEGS 353 L +EG+G+GVEGS Sbjct: 966 LALDEGKGVGVEGS 979 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 676,691 Number of Sequences: 2352 Number of extensions: 12842 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -