BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0799 (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g06140.1 68414.m00645 pentatricopeptide (PPR) repeat-containi... 29 2.0 At1g06900.1 68414.m00733 peptidase M16 family protein / insulina... 27 8.2 >At1g06140.1 68414.m00645 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 558 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 533 HNKMVSIIYVMKGFKDCIVNGSSITNTWMSS 441 H + V ++ GF+D +V GSS+TN ++ S Sbjct: 22 HTQQVHAKVIIHGFEDEVVLGSSLTNAYIQS 52 >At1g06900.1 68414.m00733 peptidase M16 family protein / insulinase family protein contains Pfam domain, PF05193: Peptidase M16 inactive domain; similar to insulin-degrading enzyme (Insulysin, Insulinase, Insulin protease) [Mouse] SWISS-PROT:Q9JHR7 Length = 1023 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 577 SRKNCEELNEIESTDTIKWYQS 512 S K EEL I+ D I WY++ Sbjct: 949 SHKEAEELRSIQKKDVISWYKT 970 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,111,198 Number of Sequences: 28952 Number of extensions: 190499 Number of successful extensions: 310 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 310 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -