BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0796 (697 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC050733-1|AAH50733.1| 99|Homo sapiens ATP-binding cassette, s... 30 9.1 AY078405-1|AAL83711.1| 99|Homo sapiens up-regulated gene 7 pro... 30 9.1 >BC050733-1|AAH50733.1| 99|Homo sapiens ATP-binding cassette, sub-family C (CFTR/MRP), member 6 protein. Length = 99 Score = 29.9 bits (64), Expect = 9.1 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 580 PMYSAIF*SVHLVF*HHTGRXRSRVHPYYRYKRWQSFTG 696 PMY + ++L+F HH GR R+ P ++ K + G Sbjct: 41 PMYLWVLGPIYLLFIHHHGRGYLRMSPLFKAKMVAAIPG 79 >AY078405-1|AAL83711.1| 99|Homo sapiens up-regulated gene 7 protein. Length = 99 Score = 29.9 bits (64), Expect = 9.1 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 580 PMYSAIF*SVHLVF*HHTGRXRSRVHPYYRYKRWQSFTG 696 PMY + ++L+F HH GR R+ P ++ K + G Sbjct: 41 PMYLWVLGPIYLLFIHHHGRGYLRMSPLFKAKMVAAIPG 79 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,315,306 Number of Sequences: 237096 Number of extensions: 1922053 Number of successful extensions: 2929 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2929 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8007229802 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -