BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0793 (696 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY113537-1|AAM29542.1| 559|Drosophila melanogaster RE61294p pro... 31 2.0 AE014297-791|AAF54271.3| 559|Drosophila melanogaster CG8112-PA ... 31 2.0 >AY113537-1|AAM29542.1| 559|Drosophila melanogaster RE61294p protein. Length = 559 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +1 Query: 490 LLGFYFIFYKHMNI*KLLLQLADRIYGSTFFIATGFHGIHGNNWELYFLLIWLY 651 L GFY I + +N LL+ DR++ ++ + + G + NW + + WLY Sbjct: 390 LCGFYLILHSWLNFTSELLRFGDRMFYKDWWTSHTYDGYY-RNWNV-VVHDWLY 441 >AE014297-791|AAF54271.3| 559|Drosophila melanogaster CG8112-PA protein. Length = 559 Score = 30.7 bits (66), Expect = 2.0 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +1 Query: 490 LLGFYFIFYKHMNI*KLLLQLADRIYGSTFFIATGFHGIHGNNWELYFLLIWLY 651 L GFY I + +N LL+ DR++ ++ + + G + NW + + WLY Sbjct: 390 LCGFYLILHSWLNFTSELLRFGDRMFYKDWWTSHTYDGYY-RNWNV-VVHDWLY 441 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,628,767 Number of Sequences: 53049 Number of extensions: 369408 Number of successful extensions: 562 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3046624548 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -