BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0793 (696 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identica... 92 4e-19 At4g32500.1 68417.m04626 potassium channel protein, putative sim... 28 5.1 >At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identical to cytochrome c oxidase subunit 3 (GI:15215914) [Arabidopsis thaliana]; similar to Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Swiss-Prot:P92514) [Arabidopsis thaliana] Length = 265 Score = 91.9 bits (218), Expect = 4e-19 Identities = 45/102 (44%), Positives = 61/102 (59%) Frame = +1 Query: 304 LSPNIEIGRI*PPSRITPFNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQRLFL 483 L+P +EIG I PP I +P++IP LNT IL SG VT AHH+++ + L Sbjct: 109 LAPAVEIGGIWPPKGIEVLDPWEIPFLNTPILPSSGAAVTWAHHAILAGKEKRAVYALVA 168 Query: 484 TILLGFYFIFYKHMNI*KLLLQLADRIYGSTFFIATGFHGIH 609 T+LL F ++ M + ++D IYGSTFF+ATGFHG H Sbjct: 169 TVLLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFH 210 >At4g32500.1 68417.m04626 potassium channel protein, putative similar to potassium channel [Solanum tuberosum] gi|1514649|emb|CAA60016; similar to AKT1 [Arabidopsis thaliana] gi|563112|gb|AAA96810; member of the 1 pore, 6 transmembrane (1P/6TM- Shaker-type) K+ channel family, PMID:11500563 Length = 880 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +1 Query: 538 LLLQLADRIYGS-TFFIATGFHGIHGNN-WELYFLLIWLYSDL 660 LL++ +Y S T F TG+ IHGNN E F+L ++ +L Sbjct: 260 LLIRYVTAMYWSITTFSTTGYGDIHGNNAEERAFILFYMIFNL 302 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,444,290 Number of Sequences: 28952 Number of extensions: 189284 Number of successful extensions: 310 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 310 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -