BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0789 (649 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 2.2 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 5.0 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 8.7 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 8.7 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 8.7 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 398 LLSRVMNLF*FYYNIFLTHYSL 463 L++R +N FYY+I YS+ Sbjct: 387 LMARCLNTLIFYYHISTYEYSI 408 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 5.0 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 71 SIPSNNCMPNPANF 30 S+PS NC P A+F Sbjct: 36 SMPSMNCSPQGASF 49 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 21.0 bits (42), Expect = 8.7 Identities = 16/62 (25%), Positives = 25/62 (40%) Frame = +2 Query: 332 ILLSTILSRVVVCCILAEDK*NLLSRVMNLF*FYYNIFLTHYSLCLIHTEKSRQVYVYYH 511 I L+ +R+ C L ++K + + L FY+ IF S L VY + Sbjct: 265 IALNDDYNRLCHLCFLLDEKLSYIILTSFLNNFYFIIFQVFESFYLHKATTLETVYYFIS 324 Query: 512 NG 517 G Sbjct: 325 LG 326 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 178 LTIRSSKESVSQEICNLLADQF 243 L I KE S++ NL+ D+F Sbjct: 332 LAIVPEKEESSRQAVNLICDKF 353 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.0 bits (42), Expect = 8.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 178 LTIRSSKESVSQEICNLLADQF 243 L I KE S++ NL+ D+F Sbjct: 332 LAIVPEKEESSRQAVNLICDKF 353 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,213 Number of Sequences: 336 Number of extensions: 3308 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16656800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -