BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0784 (659 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 24 0.96 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 24 0.96 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 24 0.96 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 1.7 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 21 9.0 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 24.2 bits (50), Expect = 0.96 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 107 LVQPQSAHVVCYQGQWSSF 51 LV + VVCY G WS++ Sbjct: 18 LVSATTDKVVCYWGTWSTY 36 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 24.2 bits (50), Expect = 0.96 Identities = 11/39 (28%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 157 LVYQKSEDRERIR*PC--SPATCSFTERESRSPKVCWFY 267 L ++ S E ++ P SP C+ RE P++C+++ Sbjct: 86 LDFRNSATAELLKNPSLSSPDECARACREGEPPRICYYH 124 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 24.2 bits (50), Expect = 0.96 Identities = 11/39 (28%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 157 LVYQKSEDRERIR*PC--SPATCSFTERESRSPKVCWFY 267 L ++ S E ++ P SP C+ RE P++C+++ Sbjct: 86 LDFRNSATAELLKNPSLSSPDECARACREGEPPRICYYH 124 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 107 LVQPQSAHVVCYQGQWSSF 51 +V + VVCY G WS++ Sbjct: 14 IVSAATNKVVCYHGIWSTY 32 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -3 Query: 603 SPSFSRKSAQPLSSGVPLPISKLTHFQLIIASQP 502 +P+FS + +S GV + + FQL + P Sbjct: 14 APAFSEQRGGVISEGVASSLQVVALFQLSETTAP 47 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,872 Number of Sequences: 336 Number of extensions: 3668 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -