BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0783 (664 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 1.6 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 6.5 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 6.5 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 25.4 bits (53), Expect = 1.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +1 Query: 430 NNFGVSIQEDTLAEIQSVGS 489 N+ GVS+Q+D A I+S GS Sbjct: 1179 NHRGVSLQDDDTASIKSYGS 1198 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.4 bits (48), Expect = 6.5 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -3 Query: 539 APGYEIS*DLTKKAAASDPTDCISASVSSCMETPKLFPS 423 APG + + KAA TD A SC+ET FP+ Sbjct: 497 APGLDGIPNAAVKAAILAYTDVFQALYQSCLET-ATFPA 534 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.4 bits (48), Expect = 6.5 Identities = 13/48 (27%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = -3 Query: 173 CLNPDVRP-INSDFESLMSLVIHXXXXXXXXXXXXSNAPPLVSKNLCS 33 C NP + +N+ F S LV+H + PP +++N+ S Sbjct: 561 CYNPIIYCYMNARFRSGFILVLHGVPGLQQLCCCIRHTPPAIARNVGS 608 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 702,771 Number of Sequences: 2352 Number of extensions: 14154 Number of successful extensions: 31 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -