BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0782 (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0659 + 30955162-30955377,30955446-30955748 28 3.6 08_02_1424 + 26982502-26983572,26984129-26984908,26988299-26990128 28 4.8 09_03_0029 + 11724581-11724583,11726413-11726610,11726874-117270... 27 8.4 >01_06_0659 + 30955162-30955377,30955446-30955748 Length = 172 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 130 KHSFRAHSPDISASSHWLGLSILHPLACL 44 KH R+H PD + LG + LH L C+ Sbjct: 51 KHISRSHPPDRQHNHSGLGTTTLHALPCV 79 >08_02_1424 + 26982502-26983572,26984129-26984908,26988299-26990128 Length = 1226 Score = 27.9 bits (59), Expect = 4.8 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = -1 Query: 481 YTGKTIYLQIYFIYYNMNKESKSISFKIRIRVWKMKLINE*TNNSSQQ 338 Y G T +L+ F+Y ++ E I ++ +R W + + T N S + Sbjct: 694 YEGLTYHLKSCFLYMSIFPEDSDIRYRRLLRRWTAEGYSRATRNRSNE 741 >09_03_0029 + 11724581-11724583,11726413-11726610,11726874-11727038, 11727217-11727283,11727645-11727812,11728070-11728194, 11728288-11728446,11728552-11728714,11728795-11728920, 11729000-11729083,11729161-11729528,11729613-11729813, 11729909-11730018,11730113-11730197,11730360-11730488, 11730580-11730667,11730805-11730893,11730968-11731267 Length = 875 Score = 27.1 bits (57), Expect = 8.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 81 QCEEAEISGECARKEC 128 +C E+++ G C RKEC Sbjct: 43 ECTESDLDGTCLRKEC 58 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,954,701 Number of Sequences: 37544 Number of extensions: 165353 Number of successful extensions: 380 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -