BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0782 (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 3.1 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 3.1 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 5.4 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 5.4 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.4 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.2 bits (45), Expect = 3.1 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -1 Query: 316 ILTCLLFLILIRNQN*SITKILLH*MCDISIFSQYGSLVRYTNPV 182 +L C L L+ ++T IL +S + YG+L+ TN + Sbjct: 561 VLVCYLNTFLLLATPTTVTCILQRFGVGVSFSAVYGALLTKTNRI 605 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.2 bits (45), Expect = 3.1 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -1 Query: 316 ILTCLLFLILIRNQN*SITKILLH*MCDISIFSQYGSLVRYTNPV 182 +L C L L+ ++T IL +S + YG+L+ TN + Sbjct: 651 VLVCYLNTFLLLATPTTVTCILQRFGVGVSFSAVYGALLTKTNRI 695 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 209 IFSSIHESGLKLINSFL 159 + S+ HE GLK+I F+ Sbjct: 105 LVSAAHEKGLKIILDFV 121 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 5.4 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 209 IFSSIHESGLKLINSFL 159 + S+ HE GLK+I F+ Sbjct: 105 LVSAAHEKGLKIILDFV 121 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.6 bits (41), Expect = 9.4 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = +1 Query: 76 PTNVKKLKYQENVLGKNVSPSLEKD*SYKKEFISFKPD 189 P N K K + ++ ++ S S YK S PD Sbjct: 937 PVNKKVYKQNDYIVDESSSSSFYSSFLYKSSESSCNPD 974 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,208 Number of Sequences: 438 Number of extensions: 2180 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -