BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0782 (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 27 9.3 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/67 (23%), Positives = 34/67 (50%) Frame = -1 Query: 448 FIYYNMNKESKSISFKIRIRVWKMKLINE*TNNSSQQMYC*NCNILTCLLFLILIRNQN* 269 FI +N ++ K++++ +K+ + N+ + CNILTCL + + N Sbjct: 205 FIPTILNTMQHKVAIKLKLK-FKLNITKVSAFNTLLLLLLLCCNILTCLTSHTSVLSSNL 263 Query: 268 SITKILL 248 +++ +LL Sbjct: 264 ALSNLLL 270 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,780,274 Number of Sequences: 28952 Number of extensions: 155708 Number of successful extensions: 324 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 323 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -