BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0776 (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 24 1.3 AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochr... 22 4.1 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.8 bits (49), Expect = 1.3 Identities = 13/47 (27%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = +3 Query: 342 DDLKKI--TQSAXAQIVHYGMNAKVGNVSFEMPQPGEMVIDKPYSEK 476 DD + + T+ + +H + + +PQP E V KP S K Sbjct: 362 DDFRGVSGTKYPILKAIHQTLGGSSNEIVEPVPQPVEEVTQKPSSTK 408 >AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 124 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 663 VLFSGNGLGPNSPIISSRLKISC 595 VL L P+ P+I RL++ C Sbjct: 50 VLKEAQRLYPSVPVIERRLEVDC 72 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,254 Number of Sequences: 336 Number of extensions: 3080 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -