BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0775 (613 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1133 - 26368323-26369457,26369556-26369635,26370145-263702... 29 2.9 04_04_0225 + 23745404-23747788 28 6.7 >12_02_1133 - 26368323-26369457,26369556-26369635,26370145-26370201, 26370508-26370601,26371006-26371092,26371179-26371268, 26371396-26371649 Length = 598 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 132 PSGQQQSRAKHIEHKKSQTKATENNWRL 215 P+G+++ A H +HKK Q K + +WR+ Sbjct: 542 PAGKKKKEASHKQHKKPQRK-KDRSWRV 568 >04_04_0225 + 23745404-23747788 Length = 794 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = +1 Query: 142 NSSPVLNT*NIRSPKLKQRKIIGDCIVSSN*LLILM 249 NS ++NT +I+ K K+ I+G C++ + LL+L+ Sbjct: 432 NSLSIINTGSIKWKKDKKYWILGSCLLLGSFLLVLI 467 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,993,820 Number of Sequences: 37544 Number of extensions: 228921 Number of successful extensions: 395 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -