BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0775 (613 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z72502-7|CAA96592.1| 140|Caenorhabditis elegans Hypothetical pr... 27 8.0 AF067222-1|AAC17017.2| 1464|Caenorhabditis elegans Hypothetical ... 27 8.0 >Z72502-7|CAA96592.1| 140|Caenorhabditis elegans Hypothetical protein C08B6.10 protein. Length = 140 Score = 27.5 bits (58), Expect = 8.0 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +3 Query: 99 SPVLVPEARRIPSGQQQSRAKHIEHKKSQTKATENNW 209 +PV RR P+ Q + A I+ + Q ++ +NNW Sbjct: 37 NPVTAAPIRRQPTVIQTTWAPQIQQPQQQLESPQNNW 73 >AF067222-1|AAC17017.2| 1464|Caenorhabditis elegans Hypothetical protein H11E01.3 protein. Length = 1464 Score = 27.5 bits (58), Expect = 8.0 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 93 RISPVLVPEARRIPSGQQQSRAKHIEHKKSQTKATENN 206 R SPV A R PS Q ++H EH+ ++ +N Sbjct: 667 RSSPVASEPAARSPSVQSSRTSEHFEHRGEVPQSPSSN 704 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,838,901 Number of Sequences: 27780 Number of extensions: 220500 Number of successful extensions: 434 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1321669750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -