BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0774 (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 24 1.6 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 23 3.7 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 23 3.7 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 23 3.7 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 23 3.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 3.7 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 4.9 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 22 6.5 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 22 6.5 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 22 6.5 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 6.5 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 145 VQSKNFDSDFNYPLNVD 195 +QS +D NYPL+VD Sbjct: 59 IQSGEYDRTKNYPLDVD 75 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = +3 Query: 198 STDSPSNTRRAKAEC*TYKYYPYKFLSNYRQCSVVN 305 S ++ + R K + Y+PY+ QC VN Sbjct: 5 SVEAVMSLRALKYPMVVHVYHPYRQPDGMNQCQAVN 40 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = +3 Query: 198 STDSPSNTRRAKAEC*TYKYYPYKFLSNYRQCSVVN 305 S ++ + R K + Y+PY+ QC VN Sbjct: 5 SVEAVMSLRALKYPMVVHVYHPYRQPDGMNQCQAVN 40 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +1 Query: 133 VGDYVQSKNFDSDFNYPLNVDIRPIVQAILDGQKPNVK 246 V Y+Q ++ DF +P +D + V+ L+ + K Sbjct: 326 VSSYLQLQDLLGDFEHPCVMDCKVGVRTYLESELAKAK 363 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +1 Query: 133 VGDYVQSKNFDSDFNYPLNVDIRPIVQAILDGQKPNVK 246 V Y+Q ++ DF +P +D + V+ L+ + K Sbjct: 241 VSSYLQLQDLLGDFEHPCVMDCKVGVRTYLESELAKAK 278 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +1 Query: 133 VGDYVQSKNFDSDFNYPLNVDIRPIVQAILDGQKPNVK 246 V Y+Q ++ DF +P +D + V+ L+ + K Sbjct: 560 VSSYLQLQDLLGDFEHPCVMDCKVGVRTYLESELAKAK 597 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 145 VQSKNFDSDFNYPLNVD 195 +QS +D NYP +VD Sbjct: 55 IQSGEYDHTKNYPFDVD 71 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 145 VQSKNFDSDFNYPLNVD 195 ++S FD NYP +VD Sbjct: 60 IKSGEFDHTKNYPFDVD 76 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 420 FFLGVDNASSDVQKNITKEMTE 485 FFL V D+Q+ + +E+ E Sbjct: 359 FFLAVMGCHPDIQEKVIQELDE 380 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 145 VQSKNFDSDFNYPLNVD 195 +QS +D NYP +VD Sbjct: 58 IQSGEYDYTKNYPFDVD 74 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/46 (26%), Positives = 19/46 (41%) Frame = +2 Query: 458 EEYYEGNDRIQXYHTDVFRDSYFNNTIKTVMSFRWIFQHCAEAQHY 595 ++YY D ++ + +D Y NN + W F H Q Y Sbjct: 146 KDYYIWVDPVKDDKGNPIKDKYPNNWLSVFNGTGWTF-HEGRKQFY 190 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,527 Number of Sequences: 438 Number of extensions: 3449 Number of successful extensions: 11 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -