BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0773 (696 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0101 + 10736987-10737100,10737263-10737301,10737397-107374... 29 2.7 06_03_1480 - 30432718-30432996,30433151-30434123,30434251-304345... 29 2.7 04_03_0199 - 12559351-12559433,12559693-12559827,12560260-125604... 29 4.7 08_02_1125 + 24488073-24488244,24488358-24488398,24488621-244888... 28 6.2 >10_06_0101 + 10736987-10737100,10737263-10737301,10737397-10737474, 10737539-10737685,10737781-10737888,10738115-10738449, 10738572-10739544,10739702-10739980 Length = 690 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 568 GTVTSYSATYPLVSKWXIMGRAFIP 642 G +T Y+ TYPL W ++G + P Sbjct: 613 GLITFYNLTYPLNRNWHVLGLGYDP 637 >06_03_1480 - 30432718-30432996,30433151-30434123,30434251-30434585, 30434929-30435075,30435498-30435569 Length = 601 Score = 29.5 bits (63), Expect = 2.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +1 Query: 568 GTVTSYSATYPLVSKWXIMGRAFIPT 645 G +T Y+ TYPL W ++G + P+ Sbjct: 524 GLITFYNLTYPLNRTWHVLGLGYDPS 549 >04_03_0199 - 12559351-12559433,12559693-12559827,12560260-12560437, 12560848-12561389,12561398-12564827 Length = 1455 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +1 Query: 70 FVKCFKCSKCYYSFKLYPGRI-FIYPEPQRVTIS*SSQYLHNLFFVLFQNIK 222 F+K +KC SF +PGR+ ++P +R+ I + L FF ++K Sbjct: 1176 FLKVYKCPSLSPSFLWFPGRVDELFPRLERLEID-DPRILSTSFFKYLGSLK 1226 >08_02_1125 + 24488073-24488244,24488358-24488398,24488621-24488889, 24489061-24489157,24489407-24489753,24489816-24490173, 24490319-24490894,24491374-24491649 Length = 711 Score = 28.3 bits (60), Expect = 6.2 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 565 SGTVTSYSATYPLVSKWXIMGRAFIP 642 +G VT ++ T+PL KW ++G + P Sbjct: 634 AGLVTFWNQTFPLDHKWHLLGLGYKP 659 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,320,446 Number of Sequences: 37544 Number of extensions: 338139 Number of successful extensions: 603 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 603 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -