BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0773 (696 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U23170-2|ABD63218.1| 150|Caenorhabditis elegans Hypothetical pr... 32 0.45 AF067608-12|AAC17651.1| 458|Caenorhabditis elegans Hypothetical... 28 5.5 >U23170-2|ABD63218.1| 150|Caenorhabditis elegans Hypothetical protein F58F12.4 protein. Length = 150 Score = 31.9 bits (69), Expect = 0.45 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +2 Query: 236 CDSMQTHLLERVAIYFSSYLLFCVGTXSRACCGFPRNVNICSNFSE 373 C+ +QT LL +A+ +F +G R CC + R +F + Sbjct: 104 CEHIQTWLLSFLAVIIVFLSIFLIGCCVRCCCSYKRKTQQSYSFDD 149 >AF067608-12|AAC17651.1| 458|Caenorhabditis elegans Hypothetical protein B0511.2 protein. Length = 458 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +1 Query: 58 NFEMFVKCFKCSKCYYSFKLYPGRIF-IYPEPQRVTIS*SSQYLHNLFF 201 NFE+ +K F+ K +Y+ P + IY + + VT S HN FF Sbjct: 270 NFELKIKFFQ--KLWYNISENPLKYRKIYADSELVTFETQSHVFHNFFF 316 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,493,786 Number of Sequences: 27780 Number of extensions: 324256 Number of successful extensions: 715 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -