BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0772 (707 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: L... 42 0.020 UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 40 0.060 UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-... 39 0.10 >UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: Like moricin - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 248 Score = 41.5 bits (93), Expect = 0.020 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +3 Query: 153 MGDDNHSPSGGPYARLPTRAINKKK*SLYSF 245 MGD NHSPSG PYA LPTRA K SL+ F Sbjct: 1 MGDGNHSPSGRPYASLPTRA-KMKLTSLFIF 30 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 39.9 bits (89), Expect = 0.060 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -3 Query: 630 SRFRSDDRFCEALLLLGPVLA 568 SRFRSD RFCEALLLLG VLA Sbjct: 85 SRFRSDGRFCEALLLLGLVLA 105 >UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-like protein; n=25; Arthropoda|Rep: Endonuclease and reverse transcriptase-like protein - Bombyx mori (Silk moth) Length = 986 Score = 39.1 bits (87), Expect = 0.10 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = +2 Query: 110 GRQRLGSAPGIAEVYGRR 163 GRQRLGSAPGIAEV+GRR Sbjct: 969 GRQRLGSAPGIAEVHGRR 986 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,619,899 Number of Sequences: 1657284 Number of extensions: 12141316 Number of successful extensions: 25570 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25018 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25568 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56611575523 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -