BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0772 (707 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0831 + 11620831-11620883,11621002-11621106,11621399-11621873 31 1.2 04_04_1460 + 33764106-33764303,33764675-33766201 29 4.8 >03_02_0831 + 11620831-11620883,11621002-11621106,11621399-11621873 Length = 210 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +2 Query: 548 GAQTGNVANTGPSKSSASQNLSSDRKRDPLRRSGEKLQWVVSM 676 GAQ + PS S+A ++ S+ K PL R E W V + Sbjct: 123 GAQEPMTNASSPSSSAARRSTPSENKNQPLPRHSEAYSWGVGV 165 >04_04_1460 + 33764106-33764303,33764675-33766201 Length = 574 Score = 28.7 bits (61), Expect = 4.8 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = +3 Query: 9 AGITEFINWQSNIVFKRKTKRISSLIKVINKITWVGSGLALPLALL 146 AG+ F NW + ++ + + +K++W G G +P AL+ Sbjct: 157 AGLKRFYNWYYVVTMMASFMALTFIAYIQDKVSW-GLGFGIPTALV 201 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,224,796 Number of Sequences: 37544 Number of extensions: 321147 Number of successful extensions: 661 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 661 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -