BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0772 (707 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC090894-1|AAH90894.1| 179|Homo sapiens C19orf54 protein protein. 31 5.3 >BC090894-1|AAH90894.1| 179|Homo sapiens C19orf54 protein protein. Length = 179 Score = 30.7 bits (66), Expect = 5.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +2 Query: 578 GPSKSSASQNLSSDRKRDPLRRSGEKLQWVVSMG 679 GP + S + D +P +R G K W VS G Sbjct: 35 GPGRDVLSTSYDEDFNHEPCQRKGHKAHWAVSAG 68 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,502,185 Number of Sequences: 237096 Number of extensions: 1852555 Number of successful extensions: 3065 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2978 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3065 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8231208258 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -