BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0772 (707 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U88175-3|AAB42280.1| 295|Caenorhabditis elegans Hypothetical pr... 30 1.9 Z80221-1|CAB02309.1| 690|Caenorhabditis elegans Hypothetical pr... 29 4.3 >U88175-3|AAB42280.1| 295|Caenorhabditis elegans Hypothetical protein F21F3.3 protein. Length = 295 Score = 29.9 bits (64), Expect = 1.9 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 292 HSRELTKYFQHYCRL*NEYKLYFFLFIALVGRRAYGP 182 H EL +YF Y + + F+F AL RR GP Sbjct: 98 HEGELWEYFSRYFLFLSVFHFSEFVFTALTNRRTLGP 134 >Z80221-1|CAB02309.1| 690|Caenorhabditis elegans Hypothetical protein ZC247.2 protein. Length = 690 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +2 Query: 551 AQTGNVANTGPSKSSASQNLSSDRKRDPLRRSGEKLQWVVS 673 A GN ++ G +S + +++ DR+ DP+ G K + ++ Sbjct: 326 ALNGNASSRGLGRSISRSSMTPDRRLDPILEDGSKQRQAIA 366 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,007,360 Number of Sequences: 27780 Number of extensions: 287167 Number of successful extensions: 590 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 578 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -